KEGG   Arthrobacter sp. YN: CGK93_17270Help
Entry
CGK93_17270       CDS       T05171                                 

Definition
(GenBank) cystathionine gamma-synthase
  KO
K01739  cystathionine gamma-synthase [EC:2.5.1.48]
Organism
arn  Arthrobacter sp. YN
Pathway
arn00270  Cysteine and methionine metabolism
arn00450  Selenocompound metabolism
arn00920  Sulfur metabolism
arn01100  Metabolic pathways
arn01110  Biosynthesis of secondary metabolites
arn01130  Biosynthesis of antibiotics
arn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:arn00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    CGK93_17270
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CGK93_17270
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CGK93_17270
Enzymes [BR:arn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.48  cystathionine gamma-synthase
     CGK93_17270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_1_2 Beta_elim_lyase Aminotran_5 DegT_DnrJ_EryC1 Met_gamma_lyase GDC-P
Motif
Other DBs
NCBI-ProteinID: ASN21234
UniProt: A0A221NMS8
LinkDB All DBs
Position
complement(3762857..3764026)
Genome map
AA seq 389 aa AA seqDB search
MSATNNAGFNTRAVHAGQAFEPRTGAVVPPLHFSSTYAQDGIGNLRSGYEYGRGGNPTRD
ALQEQLAALEGGTAAFSFGSGLAAEDSLIRAIARPGDHIVLGNDAYGGTYRLINRVLGDW
GIGNTPVDMSDLDAVAAAVAANNTRIVWVETPSNPMMKITDIEALAAVAHDAGALLVVDN
TFASPYLQTPLALGADVVVHSTTKYIGGHSDVVGGAIVVKDDELAEKIGFIQFAVGAVSG
PMDAFLTTRGLKTLGVRMDRHSDNGQAVAEWLLQRPEVEAVLYPGLPDHPGHELAAKQMK
KFGGMVSVQFKGGEAAARTVAESTSVFTLAESLGGIESLMNYPSEMTHASVKGTELAVPV
NLLRLSCGIEEAEDLIADLEQAFAKISNG
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccaccaacaacgccgggttcaacacccgcgccgtccacgccggacaggccttc
gaaccccggaccggtgctgtggtgccgccgctgcacttcagctccacctatgcccaggac
ggcatcggcaacctgcggtccgggtacgagtacggacgcggcggcaacccgacccgcgac
gccctccaggagcagttggccgccctcgaagggggtaccgcagcgttttccttcggctcg
ggcctggctgccgaggactcattgatccgtgcgatcgcccgccccggtgaccacatcgtc
ctgggtaacgacgcttacggcggcacctaccgcctgatcaaccgcgtcttgggcgactgg
ggcatcggcaacacccccgtggacatgtcggacctcgacgccgtggcagcagccgtcgcc
gcgaacaacaccaggatcgtctgggtggagacgccgtccaacccgatgatgaagatcacc
gacattgaggccctcgccgctgtagcgcacgacgccggtgccctcctggtggtggacaac
accttcgcgtctccctacttgcagactccgctcgccttgggtgctgacgtggtggtccac
tccacgaccaagtacatcggcggccactccgacgttgtgggtggcgcgattgtggtcaag
gacgatgagctggcagagaagatcggtttcatccagttcgcggtcggtgcggtttccgga
cccatggatgccttcctcaccacccgcggactgaagacgcttggcgttcgcatggaccgt
cacagcgacaacggccaggcagtggctgagtggctcctgcagcgtcccgaggtggaagca
gtgctctacccgggcctcccggaccaccccggccacgagctcgcagcgaagcagatgaag
aagttcggcggcatggtctccgtgcaattcaagggtggcgaagcagcggcacgcacggtc
gccgaatccacctcggtgttcacgctcgcggaatcgctgggtggcatcgagtccctgatg
aactacccgtcggagatgacccacgcctccgtgaagggcaccgaactggcggttccggtc
aacctcctgcgcctttcctgcgggatcgaggaagccgaggacctgatcgccgaccttgag
caggcttttgccaagatcagtaacggctga

DBGET integrated database retrieval system