KEGG   Arthrobacter sp. YN: CGK93_18590Help
Entry
CGK93_18590       CDS       T05171                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
arn  Arthrobacter sp. YN
Pathway
arn00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:arn00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    CGK93_18590
Enzymes [BR:arn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     CGK93_18590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Glyco_hydro_14 Cellulase Glyco_hydro_35 AIRC
Motif
Other DBs
NCBI-ProteinID: ASN21462
UniProt: A0A221NNG7
LinkDB All DBs
Position
4058625..4060655
Genome map
AA seq 676 aa AA seqDB search
MTSPENTSSPSVWNSIDGLAYGGDYNPEQWPKDIRLEDIELMKEAGVNFLSVAIFSWGLL
EPTEGNYDFGWLDDVLDNLHGAGIKVALATATASPPAWLARKYPEILPVTAEGVRLERGS
RRHYTPSSAVYRKYATAMTRVIAERYKDHPALALWHVDNELGCHVGEFHGEEDAAAFRAW
LERRYGSIEALNEAWGTAFWSQHYASFEDIIPPGAAPTTLNPGQQLDFARFNSWVFMDYY
RELLAVIREVTPGIPATTNFMVSSATKALDYFDWSKDMDVIANDHYLVAADPEREIELAF
SADLTRGVAGGQPWILMEHSTSAVNWQPHNQPKMPGEMLRNSLAHVARGADAVMFFQWRQ
SKAGSEKFHSAMVPHGGRDTQVWRNVVDLGEALAKMEPVKGSRVESRVAIVFDYEAWWAS
ELDSHPNKSLKYLDTMRAFHRSLYLRGITADFVHPSADLAGYDLILVCTLYSVTDQAAAS
ISAAAERGATVLISYFSGIVDERDHVRLGGYPGAFRDLLGIRSEEFHPLFPGTTVTLSDG
TAGSVWSEHVHVAGSAGASAEVLATFTDYPLDGVPALTRRSVGTGSAWYLATLPDAAGID
ALTARLVDEAGVAAVAEATAGVELSRRRADDGRSFLFAINHSREDVTVKADGAELLSGLR
FTGVVPAGAVAVIAED
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
ttgacctcccccgaaaacaccagcagtccatctgtctggaacagcatcgacggcctcgcc
tacggtggcgactacaaccctgagcagtggcccaaagacatccggctggaagacatcgag
ctgatgaaggaagccggcgtgaacttcctgagcgtcgccatcttctcctggggccttctg
gaacccaccgaaggcaactacgatttcggctggctggacgatgtcctggacaacctccat
ggagccgggatcaaggtggccctcgccacggccaccgcttctcccccggcctggcttgcc
cgcaaataccccgagatcctgcccgtcaccgcggaaggagtgcggctggaacgtggctcc
cgacgccactacacgccgtcgtcggctgtctaccgcaagtacgccaccgccatgacgcgg
gttatcgctgagcggtataaggaccaccccgccctggcgctgtggcacgtggacaacgaa
ctgggctgccacgttggcgagttccacggcgaagaagacgccgccgctttccgggcatgg
ctggaacgccgctacggctccatcgaggccctgaacgaggcgtggggaacagcattctgg
tcccagcactacgcttccttcgaggacatcatcccgccgggggcagcacccaccacgctc
aacccgggccagcaactggactttgcccgcttcaactcgtgggtgttcatggactactac
cgcgaactgctggccgtgatccgcgaggtcaccccgggcatcccggccaccaccaacttc
atggtctccagcgccaccaaggccctggactactttgactggtccaaggacatggacgtg
attgccaacgatcactacctggtggccgcggacccggagcgtgaaatcgagctcgcgttc
agcgcagacctcacccggggcgtagcagggggccagccgtggatcctgatggaacactcc
acgtcggccgtcaactggcagccgcacaaccagcccaagatgcccggcgaaatgctccgc
aactcactcgcccacgtggcgcgcggtgccgatgccgtgatgttcttccagtggcggcag
agcaaggccggctcggagaaattccactcggccatggttccccacggtggccgcgacacc
caggtgtggcgcaacgtggtggaccttggcgaggcactggccaagatggaacccgtcaag
ggatcacgagtggaatcccgggtggcgatcgtgttcgattacgaggcctggtgggcgtcg
gagctggactctcaccccaacaaatccctgaaatacctcgatacgatgcgggcgttccac
cgctccctgtacctccgcggaatcactgcggacttcgtccacccctccgcagacctcgca
ggctacgatctcatcttggtctgcaccttgtactccgtcacggaccaggccgctgcctcg
atttccgccgctgcggaacgtggcgccacggtcctgatcagctacttcagcggcatcgtc
gatgagcgcgaccacgtccgtttgggcggctaccccggcgctttccgtgacttgctgggc
atccgcagcgaggaattccacccgctgttccccggcaccacggtcacgttgagcgatgga
actgctggctctgtgtggagcgagcacgtacacgttgccgggtccgccggcgcttcggcg
gaggtcctggcgaccttcaccgactacccgctcgacggcgtcccggcactgacgcgccga
tccgtcggaaccggttcggcctggtacctcgccacgctcccggatgccgccggcatcgat
gccctgaccgctcgactggtggacgaagcgggggtggcggccgtggctgaggcgactgcc
ggcgtcgaactttcccgccgtcgcgccgacgacggccgcagcttcctgttcgccatcaac
cacagccgggaagacgtcacggtcaaggccgacggcgccgaactgctcagcggcctgcgc
ttcaccggggtcgtccccgccggagccgtggctgtcatcgcggaagactga

DBGET integrated database retrieval system