KEGG   Agrobacterium rhizogenes: B0909_01660Help
Entry
B0909_01660       CDS       T04767                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
aro  Agrobacterium rhizogenes
Pathway
aro00240  Pyrimidine metabolism
aro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aro00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    B0909_01660
Enzymes [BR:aro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     B0909_01660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30 AAA_22
Motif
Other DBs
NCBI-ProteinID: AQS61112
UniProt: A0A178H457
LinkDB All DBs
Position
1:complement(344062..344643)
Genome map
AA seq 193 aa AA seqDB search
MAKLYFNYSTMNAGKSTMLLQASYNYQERGMRTLIFTAAFDNRAGVGRVASRIGLSSDAL
TFDENTDLFAEVSALNAEAPVACVFIDEANFLSEHHVWQLADIADRLNIPVMTYGLRTDF
QGKLFPASKELLAIADELREIRTICHCGRKATMVARFDNEGKVVTEGAQIEVGGNEKYVS
FCRRHWVETVKGG
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactctatttcaattattctacgatgaatgccggcaaatcgaccatgctgctg
caggcgtcctataattatcaggaacgcggcatgcgcacgctgatcttcacggccgccttc
gacaaccgggcgggcgtcggccgcgtcgcctcgcgcatcggcctgtcctccgacgccctg
accttcgatgaaaataccgacctcttcgccgaggtatcggcccttaatgccgaagcaccg
gtcgcctgcgttttcatcgatgaagccaattttctctccgaacaccatgtctggcagctg
gccgacattgccgacaggctgaatattccggtcatgacctatggcctgcgcacggatttt
cagggcaagctattccccgcctcgaaggaactgctcgccatcgccgacgagcttcgcgaa
atccgcaccatctgccattgcggccgcaaggcgacgatggtggcccgtttcgacaatgaa
ggaaaggtcgtgacggaaggcgcgcagatcgaggtcggcggcaatgaaaaatacgtttcc
ttctgccgccgccattgggtggagaccgtcaagggcggctga

DBGET integrated database retrieval system