KEGG   Agrobacterium rhizogenes: B0909_02625Help
Entry
B0909_02625       CDS       T04767                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
aro  Agrobacterium rhizogenes
Pathway
aro00473  D-Alanine metabolism
aro00550  Peptidoglycan biosynthesis
aro01100  Metabolic pathways
aro01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:aro00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    B0909_02625
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    B0909_02625
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    B0909_02625
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:aro01011]
    B0909_02625
Enzymes [BR:aro01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     B0909_02625
Peptidoglycan biosynthesis and degradation proteins [BR:aro01011]
 Precursor biosynthesis
  Amino acid ligase
   B0909_02625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 GARS_A ATP-grasp_3 CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: AQS61279
UniProt: A0A178H4W2
LinkDB All DBs
Position
1:complement(1784587..1785513)
Genome map
AA seq 308 aa AA seqDB search
MGGKHVAVLLGGFSSERPVSLSSGNACALALEGEGYKVTRVDVGRDIAAVLGELRPDVAF
NALHGPFGEDGTIQGILEYLAIPYTHSGVLASALAMDKAQAKKVVAAAGIPVAAERVMNR
FDFTSEHPLAPPYVVKPVREGSSFGVVIVKEDQSHPPQILTSSEWRYGDQVMVERYIHGR
ELTCGVLDGEALGVTEVVPLGHNFYDYDAKYAAGGSKHVIPAEISPKIYQKIQTLAVMAH
RAIGCRGVSRSDFRYDDRFSEDGEVIWLEVNTQPGMTPTSLVPEMAAHAGRSFGNLVSWM
VEDASCLR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgggcggcaagcacgtagctgttcttttgggtggattttcgtcggagcggccggtcagc
ctgtcgtcgggcaacgcttgtgcgcttgcgctcgaaggcgagggctacaaggtcacccgg
gtcgatgtggggcgcgatatcgccgccgtgctcggtgagctgcgcccggatgtggccttc
aatgcgctgcacggtccctttggcgaagacggcaccattcagggcatcctcgaatatctc
gccattccctatacacattccggcgtgctcgcctccgcgctcgccatggacaaggcgcag
gccaagaaagttgtcgccgccgccggcatcccggttgccgccgagcgcgtcatgaaccgc
ttcgatttcaccagcgaacatccgcttgcgccgccctatgtggtcaagccggtgcgtgaa
ggctcgagcttcggtgtcgtgatcgtcaaggaagaccagtcgcatccgccgcaaatcctc
acctcttcggaatggcgttacggcgatcaggtgatggtcgagcgttatattcatgggcgc
gagctgacctgcggtgtgctcgacggcgaggcgctgggcgtcaccgaagtggtgccgctc
ggtcacaatttctatgattatgatgcgaaatatgcggctggtggctcgaaacatgtcatt
cccgcagaaatttcaccgaaaatttaccaaaaaattcaaacactggcggttatggcgcat
cgggcgatcggatgccgtggcgtaagccgttcagactttcgttacgacgaccgtttctca
gaagatggcgaagttatctggcttgaagtgaatacgcagccgggcatgacgccgacctcc
ctggtgccggaaatggcggcccatgctggccgctcctttggtaaccttgtcagctggatg
gtggaggacgcttcgtgtttgcggtga

DBGET integrated database retrieval system