KEGG   Agrobacterium rhizogenes: B0909_04580Help
Entry
B0909_04580       CDS       T04767                                 

Definition
(GenBank) molybdopterin molybdenumtransferase MoeA
  KO
K03750  molybdopterin molybdotransferase [EC:2.10.1.1]
Organism
aro  Agrobacterium rhizogenes
Pathway
aro00790  Folate biosynthesis
aro01100  Metabolic pathways
Module
aro_M00880  Molybdenum cofactor biosynthesis, GTP => molybdenum cofactor
Brite
KEGG Orthology (KO) [BR:aro00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    B0909_04580
Enzymes [BR:aro01000]
 2. Transferases
  2.10  Transferring molybdenum- or tungsten-containing groups
   2.10.1  Molybdenumtransferases or tungstentransferases with sulfide groups as acceptors
    2.10.1.1  molybdopterin molybdotransferase
     B0909_04580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MoeA_N MoCF_biosynth MoeA_C
Motif
Other DBs
NCBI-ProteinID: AQS61615
UniProt: A0A178HBJ9
LinkDB All DBs
Position
1:1408181..1409398
Genome map
AA seq 405 aa AA seqDB search
MKPLLPVDDATRRLLDAAVPVAENEILPLAECDGRVLSADLAARLTQPPFDASAMDGYAL
RSADAPAIGSVLTVIGQAAAGHAFAGTIGEGEAVRIFTGAPVPEGADTILIQEDAEVLEA
GKIRTTFAVTAGRHIRPRGQDFTEGETVLEAGRELRFTDLTLTAAMNHAALAVYRKPRIA
ILATGDELLPPGSTPQPAQIIASNTFGVAALARQAGADVVDLGIIADDDTLIRAAIGKAI
AAKVDVLVTLGGASVGDHDLVQAALKAEGMQLDFWRIAMRPGKPLMVGAIGAMQVLGLPG
NPVASLVCSLLFLEPLIRRIARRAPLERATTARTATALKANDHRQDYLRARLRTDDNGRP
VAEAYVRQDSSMMNILAHSDMLIVRPPHAPEVPAGTECPVIKLRS
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgctgctgcccgtagatgatgccacaaggcgccttctggatgcggcggttccg
gtagcggaaaacgagatattgccgctcgcggaatgtgatggccgtgttctttcggccgat
ctggcggcgcgcctcacccagcctcccttcgatgcctcggccatggacggttatgcgttg
cgcagcgccgatgcgcccgcaatcggctccgtcctcaccgtcatcggccaggcggctgcc
ggccatgcctttgccggcacgataggtgaaggcgaagccgtgcgcatcttcaccggcgcg
ccggtgcctgagggcgccgatacgattctcattcaggaagatgccgaagtgctggaagcg
ggcaaaatccgcaccactttcgcagtcaccgccgggagacatattcgcccgcgcggtcag
gatttcaccgaaggcgaaacggttctggaagccggacgagaactccgcttcaccgacctg
acacttacggcggccatgaaccacgcggcacttgccgtctaccgcaagccgcgcatcgcc
attctcgccaccggcgacgaattgctgccgccgggaagcacgccgcagccggcccagatc
atcgcctccaacaccttcggggtcgcagcccttgcaagacaggccggcgccgatgtcgtc
gatctcggcatcatcgccgatgacgacaccctgatccgcgccgccatcggcaaggcaatc
gcagccaaggtggacgtgctggtgacgctgggcggcgcctccgtcggcgaccacgatctc
gtgcaggccgccttgaaggcggaaggcatgcagctcgatttctggcgtatcgccatgcgg
ccgggaaaaccgctgatggtgggcgcaatcggcgccatgcaggttctcggcctgcccgga
aacccggtggccagccttgtctgcagcctgctgtttctcgaaccgctgattcgccggatc
gctcgccgcgcgcctttggaacgcgccacgaccgcaaggaccgcgaccgcgctgaaggcc
aacgaccaccggcaggattatctccgcgcccgtttgcgcaccgacgacaacggcaggccg
gtggcggaagcctatgtcaggcaggattcatcgatgatgaacatccttgcccattccgac
atgctgatcgtacgcccgccccatgcgccggaagtgccggcaggcacggaatgcccggtc
ataaaactcaggagctga

DBGET integrated database retrieval system