KEGG   Agrobacterium rhizogenes: B0909_05010Help
Entry
B0909_05010       CDS       T04767                                 

Definition
(GenBank) beta-hydroxyacyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
aro  Agrobacterium rhizogenes
Pathway
aro00061  Fatty acid biosynthesis
aro00780  Biotin metabolism
aro01100  Metabolic pathways
aro01212  Fatty acid metabolism
Module
aro_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:aro00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    B0909_05010
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    B0909_05010
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:aro01004]
    B0909_05010
Enzymes [BR:aro01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     B0909_05010
Lipid biosynthesis proteins [BR:aro01004]
 Fatty acid synthase
  Component type
   B0909_05010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA AfsA Cyclase
Motif
Other DBs
NCBI-ProteinID: AQS61679
UniProt: A0A178H9R9
LinkDB All DBs
Position
1:complement(1318248..1318727)
Genome map
AA seq 159 aa AA seqDB search
MLLEYFQMIDKVEAVDMATRTLKAQSVVPDKSPVFEGHFPGMPLVPGVLLIETMAQASGM
LVLAFSDFASMPFLMSVDGAKMRTFVEPGAVLDIEAVLEHDGSGFAVTKAKITSAGKKIC
DAQLKLRTMPFSEIPLGPIVKKRAEEVGLMAAIAADAQG
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgctgcttgaatattttcagatgatcgacaaggtcgaagccgtggacatggcgacgcgc
acgttgaaggcgcagtctgtcgttcccgacaagagcccggtgttcgagggccattttccc
ggcatgccgctggttccgggcgtgcttctgatcgagaccatggcgcaggcttccggcatg
ctggttctggcattttccgattttgcgtccatgccgttcctgatgtcggtcgacggcgcc
aagatgcgcaccttcgtggagccgggcgcggttctcgacatcgaggcggtgctggaacat
gacggttccggctttgccgtcaccaaggcgaagatcacctctgccggcaagaagatctgc
gacgcgcagctgaaattgcgcaccatgccgttcagcgagatcccgcttggtccgatcgtc
aagaagcgggccgaggaagtcggcctgatggcggccatcgccgcggatgcgcagggttaa

DBGET integrated database retrieval system