KEGG   Agrobacterium rhizogenes: B0909_06390Help
Entry
B0909_06390       CDS       T04767                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
aro  Agrobacterium rhizogenes
Pathway
aro00010  Glycolysis / Gluconeogenesis
aro00020  Citrate cycle (TCA cycle)
aro00620  Pyruvate metabolism
aro01100  Metabolic pathways
aro01110  Biosynthesis of secondary metabolites
aro01120  Microbial metabolism in diverse environments
aro01130  Biosynthesis of antibiotics
aro01200  Carbon metabolism
Module
aro_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:aro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B0909_06390
   00020 Citrate cycle (TCA cycle)
    B0909_06390
   00620 Pyruvate metabolism
    B0909_06390
Enzymes [BR:aro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     B0909_06390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N QRPTase_N Peptidase_M23
Motif
Other DBs
NCBI-ProteinID: AQS61926
UniProt: A0A178H9Y4
LinkDB All DBs
Position
1:1078515..1079873
Genome map
AA seq 452 aa AA seqDB search
MPINITMPALSPTMEEGNLAKWLVKEGDKVAPGDVIAEIETDKATMEVEAVDEGTVAKLV
VPAGTEAVKVNALIAILAADGEDVAEAAKGGAAAPAKAEAPKQEAAKAEAPKEESAPAKA
EKPAADQAAASSTPAPVAKSGERIFASPLARRLAKEAGLDLSAVSGSGPHGRIVKTDVEK
AAASGGAKAAPAAAASAGAPAPALAKGQSDEAVLKLFEQGSYELVPHDGMRKVIAKRLVE
SKQTVPHFYVSVDCELDTLLALRAQLNAAAPEKDGKPAYKLSVNDMVIKALALALRDVPD
ANVSWTESAMVKHKHSDVGVAVSIPGGLITPIIRKAEEKSLSTISNEMKDYGKRAKERKL
KPEEYQGGTTAVSNMGMMGVKSFSAVINPPHATILAVGAGEQRAVVKNGEIKIANVMTVT
LSTDHRCVDGALGAELIGAFKRYIENPMGMLV
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgccgataaacatcaccatgcctgccctttccccgacgatggaagagggcaatctggcc
aagtggctggtcaaggaaggcgacaaggtcgcacccggtgacgtgatcgccgagatcgag
accgacaaggcgaccatggaagtggaagccgtggacgaaggcacggttgccaagctggtc
gttccggccggcaccgaagccgtcaaggtcaacgccctgatcgccatcctcgccgccgat
ggcgaggatgtggccgaggcggcaaagggcggcgctgccgctcccgccaaggccgaggct
ccgaagcaggaagctgcaaaggccgaagcgccgaaggaagaatctgccccggccaaggct
gaaaagccggccgccgatcaggctgccgcatcttccacgccggctccggtcgcaaagtcc
ggcgagcgcatcttcgcttcgccgcttgctcgccgtctcgccaaggaagccggtctcgac
ctctcggccgtttccggttccggcccgcatggccgtatcgtcaagaccgacgtggaaaag
gctgccgcttccggtggtgcgaaggccgcaccagctgctgctgcatccgcaggcgcaccg
gctccggctctcgccaaaggtcagtcggacgaagccgtcctcaagctgttcgaacagggc
tcctacgagcttgtgccgcatgacggcatgcgcaaggtcatcgccaagcgtctggttgaa
tccaagcagacggttccgcacttctacgtctccgtggattgcgaactggacacgcttctg
gcgctgcgcgcccagctcaacgctgccgctcccgaaaaggacggcaagcccgcttacaag
ctgtcggtcaacgacatggtcatcaaggcgctggctcttgccctgcgtgatgtgcctgac
gccaacgtctcctggacggaaagcgccatggtcaagcacaagcactcggatgtcggcgtt
gccgtttccatcccgggtggcctgatcacgccgatcatccgcaaggcggaagaaaagtcg
ctctccaccatctccaacgagatgaaggactacggcaagcgcgcgaaagagcgcaagctg
aagcccgaggagtatcagggcggcacgaccgccgtgtccaacatgggcatgatgggcgtc
aagagcttttccgccgttatcaacccgccgcatgccaccatcctggcggtcggcgcgggc
gaacagcgggctgtcgtgaagaacggcgagatcaagatcgccaacgtcatgacggtcacg
ctctccaccgaccaccgctgcgtcgatggcgcgctcggagccgagctgatcggcgccttc
aagcgctacatcgaaaacccgatgggcatgctggtttga

DBGET integrated database retrieval system