KEGG   Agrobacterium rhizogenes: B0909_13610Help
Entry
B0909_13610       CDS       T04767                                 

Definition
(GenBank) glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
aro  Agrobacterium rhizogenes
Pathway
aro00500  Starch and sucrose metabolism
aro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    B0909_13610
Enzymes [BR:aro01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     B0909_13610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15 CBM53
Motif
Other DBs
NCBI-ProteinID: AQS63435
UniProt: A0A178H377
LinkDB All DBs
Position
2:complement(63141..65543)
Genome map
AA seq 800 aa AA seqDB search
MRAALDFAPGAPGIDARWTSSAKNGVGTALSKNSPIWFTLSHGILNEVYYPRIDSACTRD
LGLVVTRDDGYFSEEKRDCSSVTCPFESGIPAFHITNTATDGAYRIEKQVITDPARACVL
QHVSFFPLNGKKGDYRVSVLLAPHLVNAGNLNSAWIGDYEGRRVLFAVGRSRYLALVCNC
PWRAASAGFVGVSDGWQQLRRHGRLIEEYQRADDGNVSLAAEIDFSENHDTATLALGFGQ
TEYEAAACAVASLKSGFRRTHDAYIDNWRSWQDSLGPLDRDTHHGVNSYRVSTAVLAAHR
AADRPGAVVASLSIPWGASKGDDDLGGYHLIWPRDLVEAAGGFLAAGDHDEALAILDYLR
QVQQPSGRWPQNLWLDGKPYWPGVQMDECAFPILLADILHRHGHLDHAARADYMPMIRSA
AAYILANGPTTGEDRWEEDAGYSPFTLAVEIAALLAAADLLDMEGDAAEATHLRQTADCW
NEQIERWTFAGDQTLCAQLGISGHYVRIASPGATDSVQPSGMTPILNQTPDRAFLPTSDV
ISPDALALVRFGLRAPDDPHIVATVKAIDHCLRADLPQGPVWYRYTGDGYGEHADGTAFD
GTGQGRPWPLLTGERAHYELAAGRRGAAEALLTTMEKSAGQSGLFPEQVWDQPDRLDREL
FYGHPSGSAMPLVWAHAEHIKLLRSLADGSVFDMPPQGVERYIRNKTPSHLRIWCFNNKI
SAMPAGKVLRLDLADNAIVHWSADGWATTTDTSTTASGLGTHFADLPVQQLAAGGTIVFT
FYWRDAGVWENEDFTVRLGE
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgccgcacttgatttcgcacccggcgcacccggcattgacgcacgctggacgtcg
agcgccaagaatggcgtgggaaccgcgctgtcgaaaaattcaccgatctggtttacgctc
agccacggcatcctcaacgaggtctattacccgcggatcgatagtgcctgtacccgcgat
ctcggtcttgtggtcaccagagacgacggatatttttcggaagagaaacgagactgtagt
tccgttacctgccctttcgagagtggaattcccgcgttccacatcaccaatacggcgaca
gatggagcctaccggatcgaaaaacaggtcatcaccgatccggcgcgggcctgtgttctt
cagcatgtctccttcttcccactgaacggtaagaaaggggattatcgtgtaagcgtcctt
ctggcgccgcatctggtcaatgccggtaatctcaactccgcctggataggggattatgag
gggcgtcgggtcctgtttgcggtcggccgctcacgatatctcgctctggtctgcaattgt
ccctggcgcgctgcaagtgcgggttttgttggcgtttccgatggctggcaacaattgcgc
cggcacggacgccttattgaggagtaccagcgggcggatgacggcaatgtttcgctggct
gcggaaatcgattttagcgaaaaccacgatacggcgaccttggcgctcggtttcggccag
actgaatatgaagctgcagcctgtgctgtcgcaagtctgaagtccggcttcagacgcacg
cacgatgcctatatcgacaactggcgtagctggcaggacagtcttggccccctcgaccgc
gatacccatcacggcgttaattcctatcgcgtctcgaccgctgtgcttgccgcgcatcgt
gccgcagaccggcccggagctgtcgtggccagtctatcgatcccatggggagcttccaag
ggcgatgacgatcttggcggatatcatctaatatggccgcgagatttggtggaagccgct
ggcgggtttctggcggccggcgatcacgatgaggctttggccatccttgattatctgcgc
caggtgcagcagccctcggggcggtggccgcaaaatctctggctggatggcaagccctat
tggccgggcgttcagatggacgaatgcgcctttccaatcctgcttgcggatatcctgcat
cggcacggccacctcgatcacgctgcaagggcggattatatgccgatgatccgcagcgct
gcggcctatattctggcaaacggcccaacgaccggcgaggacaggtgggaggaggatgca
ggctatagcccgttcacgcttgccgtcgagatcgccgcgctgcttgccgccgctgatctg
ctggatatggagggcgatgcggccgaagccacgcatctgcggcagacagccgattgctgg
aatgagcagattgaaaggtggacatttgccggtgaccagaccctgtgcgcgcaacttggt
atttcgggccattatgttcgcatcgcctctcctggtgccaccgattctgttcagccctcg
ggcatgacgcccatcctcaaccagacaccggatcgcgctttcctgccaacaagcgatgtc
atcagccctgatgcactcgcgctggtccgcttcggcctgcgcgcaccggacgatccccat
attgtcgcaacggtcaaggcgatcgatcattgcctgcgcgccgacctgccgcaggggccg
gtctggtacaggtacacgggcgacggatatggtgagcatgctgatggaacagcatttgac
ggcacgggtcagggcaggccatggccccttctgaccggcgagcgtgcccattacgaactt
gctgcgggtagacgcggggcggcggaagccttgctgacgaccatggaaaaatcggcgggg
cagagcggccttttccccgagcaggtctgggatcaacccgatcgtctcgacagggagctg
ttctatggccacccgtcgggcagcgcaatgccgctggtctgggcgcatgcagaacatatc
aagcttctgcgttcgcttgccgatggttccgttttcgacatgccgccgcagggtgtggag
cgctacatccgcaacaagacgccgtcgcatcttcgaatctggtgcttcaacaacaagata
tcagccatgcccgccggcaaggttctgcggcttgacctagcggataatgccatcgtgcac
tggagcgctgacggctgggcgacaaccacagatacaagcacgacggcctccggtctcggc
acgcattttgcggacttgcccgtgcagcaactggcggccggcggcacgattgtgttcacc
ttctactggcgagatgctggagtgtgggaaaacgaggactttaccgttcgcctcggtgaa
tga

DBGET integrated database retrieval system