KEGG   Agrobacterium rhizogenes: B0909_21045Help
Entry
B0909_21045       CDS       T04767                                 

Gene name
mutT
Definition
(GenBank) 8-oxo-dGTP diphosphatase MutT
  KO
K03574  8-oxo-dGTP diphosphatase [EC:3.6.1.55]
Organism
aro  Agrobacterium rhizogenes
Brite
KEGG Orthology (KO) [BR:aro00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:aro03400]
    B0909_21045 (mutT)
Enzymes [BR:aro01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.55  8-oxo-dGTP diphosphatase
     B0909_21045 (mutT)
DNA repair and recombination proteins [BR:aro03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    B0909_21045 (mutT)
 Prokaryotic Type
    B0909_21045 (mutT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX_4 NUDIX NUDIX_2
Motif
Other DBs
NCBI-ProteinID: AQS64719
UniProt: A0A178GYY9
LinkDB All DBs
Position
2:1700850..1701263
Genome map
AA seq 137 aa AA seqDB search
MSEAGKKILLVAACALLDQDGRILLAQRPEGKSLAGLWEFPGGKVEHGETPEETLVRELD
EELGIRTKVACLAPLTFASHTYETFHLLMPLYVCRRYEGIAHGREGQALKWVKPQALRDY
PMPPADEPLIPFLQDLL
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaggcgggcaaaaagattctgctggtcgctgcctgcgcgcttctcgatcaggat
ggccgcattcttctggcgcagcggcccgagggcaagtctctcgccggcctgtgggagttt
cccggcggcaaggtggagcacggtgaaacgccggaagagacccttgtccgtgaactggac
gaggaactgggcatcaggaccaaggttgcctgccttgcgccgctgaccttcgccagccac
acctacgagacctttcacctgctgatgccgctttacgtgtgccgtcgttatgaaggcatc
gcgcatgggcgggaaggacaggcgctgaaatgggtgaagccgcaggctctgcgcgattat
cccatgccgccggccgatgagccgctgattccgttcctgcaggatctgctttag

DBGET integrated database retrieval system