KEGG   Agrobacterium rhizogenes: B0909_24230Help
Entry
B0909_24230       CDS       T04767                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
aro  Agrobacterium rhizogenes
Pathway
aro00564  Glycerophospholipid metabolism
aro01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aro00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    B0909_24230
Enzymes [BR:aro01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     B0909_24230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AQS65485
LinkDB All DBs
Position
pRi2659:13041..14576
Genome map
AA seq 511 aa AA seqDB search
MADKIHDLFVIGGGINGCGIARDAVGRGYSVALAEMNDFASGTSSGATKLIHGGLRYLEH
YEFRLVRESLMEREVLWAMAPHIIWPMRFVLPYQKGGIRPAWLIRLGLFLYDHLGGRKLL
PPTAVLDMRRDEAAKPLKALFSKAFEYSDGWVDDARLVVLNARDASDKGALIMPRTKVVS
ARRENGLWTIETVDTVSGIAAVHRARMLVNAAGPWVDHVIRGAFGKNEARNVRLVQGSHI
VVKKKFEGPRAYFFQNPDNRIIFAIPYEDEFTLIGTTDRDFSGDPKDVRISQEETEYLCK
AASEYFKEPVRQDDIVWTYAGIRPLFDDGATKAQEATRDYVLKLDGFVGSEVNRAPLLNV
FGGKLTTYRRLAEHALEKIGEAIGTKGAPWTAKSHLPGGDFPVQGYEAEVTKLHKAYPFL
AASHARRLVRRYGTRASVLLGTAGKIEDLGRLFGSDLYEAEVLYLMAHEWARTTNDILWR
RSKKGLHLSHSEVALLDQFISEIIQRQVAAQ
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggcagataagatccacgacctgttcgtaatcggcggcggcatcaacggttgcgggatc
gcgcgcgacgcggtcggtcgcggctattcggtcgcgttggcggagatgaacgactttgca
tccggcacatcatcgggtgccaccaagctcatccatgggggcctgcgttatctcgaacat
tacgagttccggctggtgcgtgaatcgctgatggagcgcgaagtgctctgggcgatggcg
ccgcacatcatctggccgatgcgcttcgtgctgccctaccagaaaggcggcatccgcccc
gcgtggctgatccggctcgggctcttcctttacgaccatctcggcggccgcaagctgctg
ccgccgacggcggtactcgacatgcgccgcgacgaggcggccaaaccgctgaaggcgctc
ttctccaaggcgtttgaatattccgacggctgggtcgacgatgcccgcctcgtggtgctc
aatgcccgcgacgccagcgacaagggcgcgctgatcatgccgcgcaccaaggttgtctcg
gcgcggcgcgagaacgggctctggacgatcgagacggtggatacggtctccgggatcgcg
gcggttcaccgcgcacgcatgctcgtcaatgcggccggtccctgggtcgaccatgtgatc
cgcggcgccttcggcaagaatgaggcgcgcaacgtccgtctcgtccaaggcagccatatc
gtggtcaagaagaagttcgaggggccgcgggcctatttcttccagaaccccgacaatcgc
atcatctttgccattccctatgaggacgagttcacgctgatcggcaccaccgatcgcgac
ttcagcggcgatccgaaggacgtcaggatctcgcaggaggagacggaatacctctgcaag
gcggcgagcgaatatttcaaggagccggtcaggcaggacgatatcgtctggacctatgca
gggatccgcccgcttttcgacgacggcgccaccaaggcgcaggaggcaacccgcgactat
gtgctgaagcttgacggcttcgtcggcagcgaggtcaacagggctccgctcctcaacgtc
ttcggcggcaagctcaccacctaccggcgtctggcagagcacgcgttggagaagatcggt
gaggcgatcggcaccaagggggctccctggacggccaagagccatctgccgggcggcgac
tttccggttcaaggctacgaggcggaggtcaccaagcttcacaaggcctatccattcctc
gccgcttcgcatgcgcgccggcttgtccgccgctatggcacaagagcatccgtccttctc
ggcactgccgggaaaatcgaggatctcggccggttgttcgggtccgatctctacgaagcc
gaagtgctctacctgatggcgcacgaatgggcgcgcacgacgaatgacattctctggaga
cgctcgaagaagggactgcatctcagccacagcgaagtggcccttctcgaccaattcatt
tctgagatcatccagcggcaggttgccgcgcagtga

DBGET integrated database retrieval system