KEGG   Agrobacterium rhizogenes: B0909_26385
Entry
B0909_26385       CDS       T04767                                 

Definition
(GenBank) HAMP domain-containing protein
  KO
K14980  two-component system, OmpR family, sensor histidine kinase ChvG [EC:2.7.13.3]
Organism
aro  Agrobacterium rhizogenes
Pathway
aro02020  Two-component system
Brite
KEGG Orthology (KO) [BR:aro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    B0909_26385
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aro01001]
    B0909_26385
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:aro02022]
    B0909_26385
Enzymes [BR:aro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     B0909_26385
Protein kinases [BR:aro01001]
 Histidine kinases
  OmpR family
   B0909_26385
Two-component system [BR:aro02022]
 OmpR family
  ChvG-ChvI (acidity sensing)
   B0909_26385
SSDB
Motif
Pfam: Stimulus_sens_1 Sensor_TM1 HATPase_c HisKA HAMP HATPase_c_2 HATPase_c_3 HATPase_c_5 MatP_C
Other DBs
NCBI-ProteinID: AXO68485
UniProt: A0A178H890
LinkDB
Position
1:complement(2698987..2700777)
AA seq 596 aa
MLKKTPETVSDSDDAEERGSERRHRIHPLTIIRRIFGNAVFSSLTRRILFFNVAATVVLV
GGILYLNQFREGLIDARVESLLTQGEIIAGAISASASVDTNSITINPEKLLELQAGQSIT
PAPNDEDLSFPINPERVAPVLRRLISPTRTRARLFDADANLLLDSRHLYSRGQVLRFDLP
PVTPETQTWGDWFTSMFNRMLQPSSLPQYKEAPGGDGSIYPEVMNALTGVRGAVVRVTEK
GELIVSVAVPVQRFRAVLGVLLLSTQAGDIDKIVHAERLAIMRVFGIATLVNIVLSLLLS
STIATPLRRLSAAAIRVRRGARTREEIPDFSARQDEIGNLSIALREMTTALYDRIDAIES
FAADVSHELKNPLTSLRSAVETLPRAKTDESKQRLTEIIFHDVRRLDRLISDISDASRLD
AELARADASPVDLDVLMKGLVDISRQIGTKKKSVTIDYTVDRKAGSKTSFVVNGHDLRLS
QIVTNLIENARSFVSEESGRITVRLSRHKDRCLVQVEDNGPGIQAEDIDRIFERFYTDRP
ASEGFGQNSGLGLSISRQIAEAHGGSLRAENVVDKYGVISGARFTLSLPAAETHER
NT seq 1791 nt   +upstreamnt  +downstreamnt
gtgttgaagaaaacgccggaaaccgtctcggatagtgacgatgccgaagaacgcggcagc
gaacgccgccatcgtatccatccgctgacgatcatccggcgcattttcggcaatgcggtg
ttttccagcctcacacgccgcattcttttcttcaatgtcgccgcgacggtcgttctggtc
ggcggtattctctatctcaaccagttccgcgaagggctgatcgatgcgcgggtggaaagc
ctcctgacgcagggtgaaatcatcgccggcgcgatttccgcctccgcttcggttgacacc
aattcgatcaccatcaatccggaaaaactcctcgaattgcaggctgggcagagcattacc
cctgcccccaatgatgaggatttgagtttcccgatcaatccggaacgggtagccccggtt
ctgcggcggctgatttcgccgacgcgcacccgcgcgcggctgttcgatgccgatgccaat
ctgctgctcgactcacggcatctttattcgcgcgggcaggttctgcgcttcgatctgccg
ccggtaacgccggaaacccagacctggggcgactggttcaccagcatgttcaaccgcatg
ctgcagccgagcagcctgccgcaatacaaggaagcgccgggcggcgacggctcgatctat
ccggaagtgatgaatgcgctgaccggcgtgcgcggcgcggtcgtgcgcgtgaccgaaaaa
ggcgagctgattgtttcggtcgccgtgccggtacagcgcttccgggccgtgctgggtgtt
ctgctgctctccacgcaggccggcgatatcgacaagatcgtgcatgcggaacgccttgcc
atcatgcgcgtgttcggcatcgccacccttgtcaatatcgtgctgtcgctgcttttgtcc
tcgaccatcgccacgccgctgcggcggctgtccgccgccgctattcgcgtgcgccgcggc
gcgagaacccgcgaggagataccggatttctcggcgcgtcaggatgaaatcggcaatctt
tcgattgccttgcgcgagatgacaacggcgctttacgaccgtatcgatgccatcgaaagc
ttcgccgccgatgtcagccacgaactcaagaaccccctgacctcgctgcgcagcgccgtg
gaaaccctgccgcgcgccaagactgacgagtcgaaacagcggctgaccgagatcatcttc
cacgatgttcgccgcctcgaccgcctgatcagcgatatttcggacgcgtcgcggctcgat
gcggaactggcgcgcgcagatgcctcgcctgttgatcttgatgtgctgatgaagggtctg
gtcgatatatcccgccagattggcaccaagaaaaagagcgtgacgatcgattatactgtg
gaccgcaaggcggggagcaaaacctccttcgtggtgaatggccacgatcttcgcctcagc
cagattgtcaccaatctgatcgagaatgcccgctctttcgtatcggaggaaagcggccgc
atcaccgtgcggctgtcgcgccacaaggaccgctgcctcgtgcaggtggaagacaacgga
cctggcattcaggcggaagatatcgaccgtattttcgaacggttttacaccgaccgcccg
gcaagcgaaggcttcggccagaattcgggccttggtctttccatcagccgccagatcgcc
gaagcccatggcggcagcctgagggcggaaaatgtcgtcgacaaatatggcgtgatatca
ggcgcgcgcttcaccctgtcgctgccggcggccgaaacccatgaacgctga

DBGET integrated database retrieval system