KEGG   Arthrospira platensis: NIES39_A00310Help
Entry
NIES39_A00310     CDS       T02608                                 

Definition
(GenBank) putative methylisocitrate lyase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
arp  Arthrospira platensis
Pathway
arp00440  Phosphonate and phosphinate metabolism
arp01100  Metabolic pathways
arp01120  Microbial metabolism in diverse environments
arp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:arp00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    NIES39_A00310
Enzymes [BR:arp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     NIES39_A00310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase CTP_transf_like ComA
Motif
Other DBs
NCBI-ProteinID: BAI87872
UniProt: D4ZW93
LinkDB All DBs
Position
complement(21593..22891)
Genome map
AA seq 432 aa AA seqDB search
MKKVYVGMSADLVHPGHLNILKTAQQYGEVIVGLLTDQAIASYKRLPYMAFEQRREVIEN
IKGVSQVIPQTTLDYIPNLRSIKPDYVIHGDDWREGVQRETRQRVIETLEEWGGELIEVP
YTKGISSTQLNKALREIGTTPEVRLKSLRRMLQAKPLLRFLDIHNALSGLIVENTFIETP
QGRREFDGMWASSLTDSTAKGKPDIEAVDVSARMTTLNEVIEVTTKPIIYDADTGGKTEH
FTFTVRTLERLGVSAVIVEDKTGLKKNSLFGTEVPQTQDSIENFCQKIRAAKKAQTTDDF
MLIARIESLILGKGLDDALERAQAFIKAGADGIMIHSRQKTPDEVFAFCQDYNRLENRKP
LIAVPSSYNSCHEEELQAQGVNIVIYANQLLRSAYPAMVNTAQTILKHQRAQECEPQMLP
IKDILELIPGTK
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtctatgttggaatgagtgccgacctagttcatcccggtcacttaaacatc
ctgaaaactgctcaacagtatggggaagtcatcgtcggtctactgactgaccaagcgatc
gccagctataaacgcctcccctacatggcatttgagcagcggcgagaagtgatcgaaaac
atcaaaggagtaagtcaggtcattccccaaaccaccctggattatattcccaacctacgc
agcatcaaacccgattacgtcattcacggggacgattggcgagaaggggtacagcgagag
acccgtcagcgggtcatagaaaccctagaggagtggggcggcgaactcatcgaagttccc
tatactaaaggtatctcctcaactcaactaaacaaagccctacgggaaatcggcaccact
ccagaagtacgcctgaaatctctgcgtcggatgctgcaagccaaaccactcctgcgattc
ctagatatccataacgccctcagtggcttaatcgttgaaaacactttcatcgaaaccccc
caaggtcgtcgagaatttgatgggatgtgggcgagtagcctaacagattcgacagccaaa
ggcaaacccgacatcgaagccgttgatgtatctgcccgtatgaccacacttaacgaagtc
atcgaagtgaccaccaaacccataatttatgatgcggacactggtggtaaaacggaacat
tttaccttcactgtacgcaccctagaaaggttaggagtctccgctgtcatcgtcgaagat
aaaaccggtctcaagaaaaactccctattcggcacggaagttccccaaacccaagatagc
atcgaaaatttttgccaaaaaatccgtgcagccaaaaaagcccaaaccacagatgatttc
atgttgattgcccgcatcgaaagcctgattttaggcaagggactcgatgatgccttagaa
cgagcccaagccttcattaaagccggagccgacggcatcatgattcacagccgtcagaaa
acccctgatgaagtgtttgcattttgccaagactataaccgcttagaaaatcgtaaaccc
ctgatcgctgtgccttcgagttataacagttgtcatgaggaggaactgcaagcccagggt
gtaaacatagttatctatgctaatcagcttttgcggagtgcttacccagctatggtaaat
accgctcaaactatcttaaaacatcagcgcgctcaagagtgtgagccacaaatgttgcct
atcaaagacatactagaacttattccaggaactaagtaa

DBGET integrated database retrieval system