KEGG   Arthrospira platensis: NIES39_A05590Help
Entry
NIES39_A05590     CDS       T02608                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
arp  Arthrospira platensis
Pathway
arp00473  D-Alanine metabolism
arp00550  Peptidoglycan biosynthesis
arp01100  Metabolic pathways
arp01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:arp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    NIES39_A05590
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NIES39_A05590
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    NIES39_A05590
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:arp01011]
    NIES39_A05590
Enzymes [BR:arp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     NIES39_A05590
Peptidoglycan biosynthesis and degradation proteins [BR:arp01011]
 Precursor biosynthesis
  Amino acid ligase
   NIES39_A05590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: BAI88397
UniProt: D4ZZ73
LinkDB All DBs
Position
complement(541498..542574)
Genome map
AA seq 358 aa AA seqDB search
MTKLRVGLLFGGCSGEHEVSITSAKAIANALSIDPNPSKYEVVPIYIEKNGVWHRGTEAE
AVLESGQPLTVTGEVIPSDRIPNPATVKDIDLWFPILHGPNGEDGTVQGMLTLMQVPYVG
SGVLGSAVGMDKIAMKMAFSQAGIPQVRYQAVRRSQVWSNPCIFPKLCDDLDAALGYPCF
VKPANLGSSVGISKVRSRQELETALDAAATYDRRIIVEAGVEARELECAVLGNDYPKASV
VGEISYNSDFYDYETKYTDGKANLMIPAPIDTAIASKVRDMAIEAFLAVDAAGLARVDFF
YIEKTGEVLLNEINTLPGFTALSMYPQLWSATGVSFPELVNQLIELALERHTQAAEAP
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaactccgggttggactgttgtttggtggatgttcgggagagcatgaggtttcc
attacctcggctaaggcgatcgccaatgcactctctatagacccaaaccccagtaaatat
gaggtagtccccatatatatagaaaaaaatggggtgtggcatagagggacggaggcggaa
gcggttttagagtcgggtcaacccctaacagtgacaggggaagtgataccaagcgatcgc
attcctaaccccgccactgtcaaggatatagacctttggtttccaattctccacggtccc
aatggtgaggatggcacagttcagggtatgttaaccttaatgcaagtgccttatgtgggt
tcgggggttctcggttctgcggttggtatggataaaatcgccatgaaaatggctttttct
caggcgggaattccgcaagtgcgttatcaagcagtgcggcgtagtcaagtatggtctaac
ccctgtattttcccgaaattatgcgatgaccttgatgcggctttgggttatccctgcttt
gtgaaacctgctaatttggggtcctctgttggcatttccaaagtgcgatcgcgtcaggaa
ctcgaaaccgctttagatgctgcggctacctatgatcggcgaattattgtagaagcggga
gtcgaagccagagaactagaatgtgctgttttaggcaatgattatccgaaagcgtcggtg
gtgggagaaattagctataatagcgatttctatgactacgaaactaagtatactgatggc
aaagctaatctgatgattccagcgcctattgatacagcgatcgcttctaaagtccgagat
atggcgatcgaagccttcctcgctgtcgatgctgctggactagcgcgggtggatttcttc
tatatcgaaaaaaccggagaagtcttgctgaatgaaatcaacaccctccccggttttacc
gctttaagtatgtatccgcaactgtggtcagccacaggagtcagctttcccgaattggta
aatcaactcattgaattagccctagaaaggcatacccaagccgctgaagccccctaa

DBGET integrated database retrieval system