KEGG   Arthrospira platensis: NIES39_A06550Help
Entry
NIES39_A06550     CDS       T02608                                 

Definition
(GenBank) hypothetical protein
  KO
K07058  membrane protein
Organism
arp  Arthrospira platensis
Brite
KEGG Orthology (KO) [BR:arp00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    NIES39_A06550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB
Motif
Other DBs
NCBI-ProteinID: BAI88493
UniProt: D4ZZG9
LinkDB All DBs
Position
complement(624465..625721)
Genome map
AA seq 418 aa AA seqDB search
MPCQFLYHLNRAILHCRLKLPSLNQIIDYAAEIIVNLLLTLLHLLWKLLLTLLQGLKTLW
ILNRKAWCLGFELVAAKTADLLIILFKCLWWLGRQIKKRVVDFVLFFTYLNWQTFHSLGV
RTVQQRLYGLSAEMAYHSTLALVPALLALLAAIGSNESLQSTLLEMANLLGEVVPEQVQK
LIGATMSQSGRSLSPRLFSFSFIISIWLFSGVISSAMEALNRIHQVPQEKIRPFWKSKLI
AIALTLGTLLLLIMALGAVFISDFLVEIIARKSCILETVGNCPLDKIDMCLAQEPVQDCL
LQSTLLDTWNRLQWPITLGIVSTNFAFIYRYGPSYRKPKTPLIPGSILAAIFWALISNLF
RWYVYQSEYYNLIYGAIGTFIVLLLWLNISSLVVLMGAQLNATVGDEIRRRKTQKDSR
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
ttgccctgtcaatttttatatcacctaaatagggcaatattgcactgtcggttaaagctg
ccaagccttaaccagatcatagactatgctgctgaaattatagttaacctgttattaaca
ctcctacacctgctatggaagctgctgttaaccctgctacagggattgaaaaccctatgg
atactcaaccgtaaagcatggtgtctggggttcgagttggtagctgccaaaaccgccgat
ctgctgattatccttttcaaatgcctatggtggctaggtcgtcaaatcaaaaagcgcgtg
gtggattttgttctattctttacctacctcaattggcaaacttttcatagtttaggagtt
cgtactgttcaacaacggttatacggtttgtctgccgaaatggcttatcactctacccta
gcactggttcccgcgcttttagctctgttagccgctattggttccaatgaatctctacaa
tctaccctattggaaatggcgaatttgttaggggaagtagtaccagaacaagtccaaaaa
ttgattggggcaactatgagccaatctggcagaagtcttagccctagattattctccttt
agttttattatttctatttggctgttttctggggtgattagttccgctatggaagcctta
aataggattcatcaagtaccccaagaaaaaatcagacctttttggaagtctaaattaatt
gcgatcgccttaactttggggacattattactattaattatggcattaggagccgtgttt
attagtgattttttggtggaaattatcgcccgcaaaagttgcatcttagaaacagttggt
aattgtcccctagataaaattgatatgtgtttggctcaagaacctgtccaagattgtttg
cttcaatcaacattattggatacttggaatcgtctacaatggccaattaccctcggcatt
gtctccactaactttgcttttatctatcgttatggtcctagttacagaaagcctaaaact
cccctaattcctggctcaattctagccgcgattttttgggctttaatctctaatttattt
cgctggtatgtttaccagtctgagtattataatcttatctatggggcgatcggcactttt
attgttctcctgttatggttaaacattagttccttagtagtgcttatgggggcacaatta
aatgctacagtaggtgatgaaattcgtcgtagaaaaacacaaaaggatagtcgctga

DBGET integrated database retrieval system