KEGG   Arthrospira platensis: NIES39_J02310Help
Entry
NIES39_J02310     CDS       T02608                                 

Gene name
ccmA
Definition
(GenBank) phospho-2-dehydro-3-deoxyheptonate aldolase
  KO
K03856  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
arp  Arthrospira platensis
Pathway
arp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
arp01100  Metabolic pathways
arp01110  Biosynthesis of secondary metabolites
arp01130  Biosynthesis of antibiotics
arp01230  Biosynthesis of amino acids
Module
arp_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:arp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NIES39_J02310 (ccmA)
Enzymes [BR:arp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     NIES39_J02310 (ccmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1 DAHP_snth_FXD NeuB Cuticle_1
Motif
Other DBs
NCBI-ProteinID: BAI91283
UniProt: D4ZU18
LinkDB All DBs
Position
complement(3499567..3500631)
Genome map
AA seq 354 aa AA seqDB search
MIIVMKVGSPEAEIERLNDELRSGWGLTPEKIVGKHKVVIGLVGETAGLDPLQLQEISPF
IEQVLRVEKPYKRASREFRHGESSNVAVTTPSGIVNFGQNLPLVVVAGPCSVENEQMIVE
TALRVKAAGAKFLRGGAYKPRTSPYAFQGHGESALNLLAAAREASGLGVITELMDADDLE
KLSEVADVIQIGARNMQNFSLLKKVGAQDKPVLLKRGMSATIEEWLMAAEYILAAGNPNV
ILCERGIRTFDRQYTRNTLDLSVIPVLRSLTHLPIMIDPSHGTGFAEHVPSMAKAAIAAG
TDSLMIEVHPNPAKAMSDGPQSLTPADFDQLMQDLAVIGKSVNRWSDQPVAVPA
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgattattgtaatgaaagttggctctccagaagccgaaatcgaacgtcttaatgatgaa
ctccgcagcggttggggtttaacaccagaaaaaatcgtcggaaaacataaagttgtgatc
gggctggtaggagaaacagcaggtcttgatcccctacaactccaggaaattagcccattt
attgaacaggtgttacgagttgaaaaaccctacaaacgtgctagtcgggaatttcgtcac
ggagagtcgagtaatgtagctgttaccactcccagcggaatagttaactttggccaaaat
cttcccctggtggtggtggcgggtccctgttcggtagaaaatgaacaaatgatcgtggag
acggcgctgcgggtgaaagctgctggggcgaagttcttacgcggtggcgcatataaacct
cgcacgtctccatacgctttccaaggtcatggagaaagcgctctgaaccttttagctgct
gctcgtgaagcgtcaggactgggagtgattacggagttaatggacgcggacgacttagaa
aagttgtctgaggtggcggatgtgatccaaattggcgctcgcaatatgcaaaatttctcc
ctgctgaaaaaagtaggggctcaggataaaccagtattgctgaagcggggtatgtctgcc
actattgaggaatggctaatggcggcggaatatatcttagcggcgggaaacccgaatgtg
attctgtgtgaacggggaatccgcactttcgatcgccaatatacccgcaatacccttgat
ttgtcggtgattccggtattgcgatcgctcactcacttaccaattatgattgacccaagc
cacggcacgggatttgcggagcacgttccatctatggctaaagcggcgatcgcggctggg
acagactcgctcatgatcgaagttcaccccaacccagccaaagccatgtcagatggtcct
caatccctgactccggcagattttgatcaactaatgcaagacctagccgttattggtaaa
tcggtgaaccgctggtcggatcagccagttgcagtccccgcctag

DBGET integrated database retrieval system