KEGG   Arthrospira platensis: NIES39_K02850Help
Entry
NIES39_K02850     CDS       T02608                                 

Gene name
rbcL
Definition
(GenBank) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
arp  Arthrospira platensis
Pathway
arp00630  Glyoxylate and dicarboxylate metabolism
arp00710  Carbon fixation in photosynthetic organisms
arp01100  Metabolic pathways
arp01120  Microbial metabolism in diverse environments
arp01200  Carbon metabolism
Module
arp_M00165  Reductive pentose phosphate cycle (Calvin cycle)
arp_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
arp_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:arp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NIES39_K02850 (rbcL)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    NIES39_K02850 (rbcL)
Enzymes [BR:arp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     NIES39_K02850 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: BAI91932
UniProt: D4ZVW7
LinkDB All DBs
Position
complement(4152769..4154199)
Genome map
AA seq 476 aa AA seqDB search
MSYSQTQTKSKAGYQAGVKDYKLTYYTPDYTPKDTDILAAFRVSPQPGVPPEEAGAAVAA
ESSTGTWTTVWTDLLTDLDRYKGRCYHIEPVPGEDNQFFCFVAYPLDLFEEGSVTNMLTS
IVGNVFGFKALRGLRLEDMRIPIAYLKTFQGPPHGITVERDKLNKYGRPLLGCTIKPKLG
LSAKNYGRAVYECLRGGLDFTKDDENINSQPFMRWRDRFLFVQEAIEKAQAETNEIKGHY
LNVTAPTCEEMMKRAEFAKEIGTPIIMHDFFTAGFTANTTLARWCRDNGLLLHIHRAMHA
VVDRQRNHGIHFRVLAKCLRMSGGDHLHSGTVVGKLEGEKGITMGFVDLMREDHIEEDRS
RGIFFTQDWASMPGVMPVASGGIHVWHMPALVEIFGDDSCLQFGGGTLGHPWGNAPGATA
NRVALEACIQARNEGRNLFREGGDVIREACKWSPELAVACELWKEIKFEFEAMDTL
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtcttactctcaaactcaaaccaaatcgaaagccggatatcaggctggtgtaaaagac
tataagctgacgtattacacgccggattacacacccaaagatacagatattctggcagcg
ttccgtgtttcacctcaaccaggagttcccccggaagaagcgggagcagcagtagcagca
gaatcttcaaccggaacttggacaactgtatggactgacctgttaacagacctcgatcgc
tacaaaggtcgttgctaccacatcgaaccagtacccggcgaagacaatcagtttttctgc
tttgttgcctatcccttggatctgtttgaagaaggttctgttaccaatatgttaacctcc
atcgtgggtaacgtatttggatttaaggcactgcggggcttgcgcctggaagatatgcgg
attccaattgcttacctcaaaaccttccaaggccctccccacggtatcaccgttgagcgg
gacaaattgaacaaatacggtcgtcccctgttgggttgcacaatcaaacctaaactgggt
ctgtcggctaaaaactacggtcgggcggtttatgagtgtctgcgtggtggtttagacttc
accaaagacgacgaaaacatcaactctcaaccattcatgcgctggcgcgatcgcttccta
tttgtacaagaggcgatcgaaaaagcccaggctgaaaccaacgaaattaagggtcactac
ctaaacgtaacagcccccacctgcgaagaaatgatgaaacgggcggaatttgccaaagaa
atcggcacccccatcatcatgcacgacttcttcaccgctggttttaccgccaacaccacc
ctggctcgttggtgtcgtgataatggtctgttgctgcacattcaccgcgctatgcacgcc
gtggttgaccgtcaacgtaaccacggtatccacttccgggttctcgccaagtgtctacgg
atgtccggtggtgaccacctgcactctggtacagttgtaggtaaactcgaaggtgaaaaa
ggtatcaccatggggtttgtagacctgatgcgggaagaccacatcgaagaagatcgttct
cgtggtatcttctttacccaagattgggcttctatgcctggtgtaatgcctgttgcttcc
ggtggtattcacgtttggcatatgccagctttggtagaaatcttcggtgatgattcctgc
ttacagttcggtggtggtactttgggacacccatggggtaatgctcctggtgcaactgct
aaccgtgtggctctcgaagcctgcatccaagctcgtaacgaaggccgtaacctgttccgt
gaaggcggcgacgtgattcgtgaggcttgcaagtggagtcctgaactggctgtggcttgc
gaactttggaaagaaatcaaattcgagttcgaggctatggataccctgtag

DBGET integrated database retrieval system