KEGG   Arthrospira platensis: NIES39_O00860Help
Entry
NIES39_O00860     CDS       T02608                                 

Gene name
nrtB
Definition
(GenBank) nitrate ABC-type transport permease protein
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
arp  Arthrospira platensis
Pathway
arp00910  Nitrogen metabolism
arp02010  ABC transporters
Module
arp_M00438  Nitrate/nitrite transport system
arp_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:arp00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    NIES39_O00860 (nrtB)
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    NIES39_O00860 (nrtB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:arp02000]
    NIES39_O00860 (nrtB)
Transporters [BR:arp02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    NIES39_O00860 (nrtB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 TrbE
Motif
Other DBs
NCBI-ProteinID: BAI93337
UniProt: D5A4D9
LinkDB All DBs
Position
complement(5655196..5656032)
Genome map
AA seq 278 aa AA seqDB search
MTSPTYRRRHKFKFSPQRWLKAVLNKGKKLIPSAVAILIFLVVWEVFTAVSDSTLPGPIR
TVSETWELIIDPFFDHGGIDKGLFWQILTSLQRVALGFSLAVVVGVSLGVLIGTNTLMYR
ALDPIFQILRTIPPLAWLPISLAGFERANPSAIFVIFITAIWPIIINTTEGVRQIPQDYN
NVSRVLRLDRKTYFFKILFPATVPYIFTGLKIGIGLSWLAIIAAEMLIGGVGIGFFIWDA
WNSSRMSDIILAVIYVGVVGLLLDKFITFLASLVVSED
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgacttctcctacttatcgccgacgccataaatttaaattttccccacaacggtggctt
aaagccgttcttaacaaggggaaaaagctgattccatctgcggttgctattctgattttc
ctggttgtttgggaggtgttcacggctgtttccgattcgacgttgcccggtcctatccgc
acagtgtcagaaacttgggaattgattatcgacccgttttttgaccacggcggcattgat
aaggggctattctggcaaattttgacgagtttgcaacgggtggccttggggttctccctc
gctgtggtggtgggagtctcgttaggagttctgattggtacgaacactctaatgtaccgt
gccttagacccgatttttcaaatcttgagaacgattccccccttggcttggctaccgatt
tccttggcaggctttgagcgagcaaacccttcggctatttttgtgatttttattacagca
atttggccgattattatcaatacaactgagggagtgcggcaaattcctcaggattataat
aatgtgtcacgggtgctacgacttgaccgcaagacctatttctttaaaatcctcttcccg
gcaacggttccctatatttttacgggactcaagattgggattggtctgtcttggctggca
attatcgccgccgaaatgttgattggtggtgtgggtattggtttctttatctgggatgcc
tggaacagttctcgcatgagtgacattatcctagcggtgatttatgtcggggtcgtcggc
ctactgctggataagtttattaccttcttggccagtttggtggtgtctgaagactaa

DBGET integrated database retrieval system