KEGG   Arthrospira platensis: NIES39_R00160Help
Entry
NIES39_R00160     CDS       T02608                                 

Gene name
gcvT
Definition
(GenBank) putative glycine cleavage T-protein
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
arp  Arthrospira platensis
Pathway
arp00260  Glycine, serine and threonine metabolism
arp00630  Glyoxylate and dicarboxylate metabolism
arp00670  One carbon pool by folate
arp01100  Metabolic pathways
arp01110  Biosynthesis of secondary metabolites
arp01130  Biosynthesis of antibiotics
arp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:arp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NIES39_R00160 (gcvT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NIES39_R00160 (gcvT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    NIES39_R00160 (gcvT)
Enzymes [BR:arp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     NIES39_R00160 (gcvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C SoxG DUF2106
Motif
Other DBs
NCBI-ProteinID: BAI94325
UniProt: D4ZQJ6
LinkDB All DBs
Position
complement(6630961..6632073)
Genome map
AA seq 370 aa AA seqDB search
MKPTLTRTPLYDLSVELKGRMVPFSGWEMAVQYSGITQEHQAVRSQVGLFDISHMGKFSL
QGEQLINALEPLFPSSLSRLQPGQAQYTVLLNSSGGILDDVIFYYQGLDPATGNQRGMMI
VNAATKSRDKAWVVAHLEGTGVALEDLSRSQVLIAVQGPQAEAVLGPLVEADLSAVANFG
HIETTLLGKPAFIARTGYTGEDGFEVMVNPHTGVNLFRHLIEVGATPCGLGARDTLRLEA
AMALYGQDIDTHTTPLEAGLGWLIHWDEKGDFIGRESLESQKSGGLSRRLVGLEMQGRYI
ARHGYPVKAGGEVVGEITSGTMSPTLEKAIALAYVPVELAKIGRQVEVEIRNKIYPATVV
KRPFYRSPHR
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccaaccctgactcgcacccctctatatgacctatccgttgaactcaaaggccgg
atggttccattttcaggctgggaaatggcggttcagtattccggtattacccaagaacat
caagcagtgcgatcgcaagtgggactatttgacatctcccacatgggcaaattttccctc
caaggtgaacagctaatcaatgccctcgaacccctatttccctctagtctcagtcgtcta
caacccggtcaagcccaatatacagtcctattaaatagcagtggcggcatattggatgat
gtcattttttactaccaaggcttagacccagccacaggaaaccagcggggaatgatgatt
gttaatgcagccaccaagtccagagataaggcttgggttgtcgcccatttggaaggaacc
ggagtcgccctagaagacctatctcgcagccaggtattaattgcagtccagggacctcaa
gcggaagccgtccttggacccctagtagaagccgacttatcagcagttgccaattttgga
catatagaaaccaccctattaggaaaacctgcatttatcgcccgcaccggatacaccgga
gaggatgggtttgaggtaatggtaaatccccacaccggagtaaatttatttcgacactta
atagaagtgggggcaactccctgtggtttgggcgctagagataccctgcgtttagaagcg
gcaatggctttgtatgggcaagatattgatacccataccacccctttagaggccggttta
ggctggttaatccattgggatgagaagggagactttatcggccgtgagtccctagaatcg
caaaaatcagggggtttatcgaggcggttagtggggttagaaatgcaggggcgatatatt
gcccgccacggttatcctgtgaaggctggcggcgaggttgtgggagaaattaccagcggc
acaatgtcccctaccctggaaaaggcgatcgccttagcctatgttccggtagaattagcc
aaaatcggccgccaagtagaagtagaaatccgtaataaaatctacccggcaacagtggtt
aaacgtcccttctatcgttccccacatcggtag

DBGET integrated database retrieval system