KEGG   Arthrobacter sp. QXT-31: BWQ92_02910Help
Entry
BWQ92_02910       CDS       T05056                                 

Definition
(GenBank) translation initiation factor IF-2
  KO
K02519  translation initiation factor IF-2
Organism
arq  Arthrobacter sp. QXT-31
Brite
KEGG Orthology (KO) [BR:arq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:arq03012]
    BWQ92_02910
   03029 Mitochondrial biogenesis [BR:arq03029]
    BWQ92_02910
Translation factors [BR:arq03012]
 Eukaryotic type
  Initiation factors
   MTIFs
    BWQ92_02910
 Prokaryotic type
   BWQ92_02910
Mitochondrial biogenesis [BR:arq03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BWQ92_02910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU IF-2 IF2_N MMR_HSR1 Ras GTP_EFTU_D2 Roc FeoB_N RsgA_GTPase MMR_HSR1_Xtn PduV-EutP
Motif
Other DBs
NCBI-ProteinID: APX00815
UniProt: A0A1P8LYE2
LinkDB All DBs
Position
complement(617167..620034)
Genome map
AA seq 955 aa AA seqDB search
MAKVRVHELAKELGITSKDAVTKLQELGEFVRSASSTIEAPVVRKLRNAFPAAAASKSEA
PVAAPKSPAKPAESRPAPAPGPAAPKAAAPAPAPAPAPAPAPKAEAPAAPAAPAAPAAGT
PAAPSTGAKPGARPAPKAETPARPGGAPRPGGPRPGNNPFATSQGMPRGRGGDGERPPRP
GNNPFATSQGMPRPGGGRTDADRPGGPRPAAGAGGPRPGAPRPGATPGPRPAAGAGGPRP
GGPRPGAGGNRPTPGMMPNRTERPAPAGAGRPGGGGRGPGRPGAPGTGGPGGGGGAPAGG
GFGKGGRGRGGTQGAFGKGGAGRGKQRKSKRAKRQELEQMSAPSLGGVSVPRGDGNTVIR
LRRGSSITDFADKIEANPAALVTVLFHLGEMATATQSLDEDTFALLGEELGYKLQVVSPE
DEERELLSTFDIDVEAELEAEGDEELEARPPVVTVMGHVDHGKTRLLDAIRNSDVVAGEH
GGITQHIGAYQISHEHEGALRDITFIDTPGHEAFTAMRARGAKVTDIAILVVAADDGVMP
QTVEALNHAQAANVPIVVAVNKIDKEGANPDKVKGQLTEYGLVPEEYGGDTMFVEVSARQ
NLNIDELIDAVLLTADAALDLRANPDKAARGIAIEANLDKGRGSVATVLVQSGTLAVGDT
IVAGTAHGRVRAMFDEDGEALDVALPSRPVQVLGLSNVPRAGDTFLVTADERTARQIAEK
REAAERNAQLAKRRKRISLEDFDQAVAEGKIDTLNLILKGDVSGAVEALEDALLKIDVGE
GVQLRVIHRGVGAITQNDVNLATVDSAVIIGFNVKPAERVAELADREGVDMRFYSVIYSA
IDDIELALKGMLKPEYEEVQLGTAEVREVFRSSKFGNIAGSIVRTGTIRRNTKARISRGG
KLIGDNLTVETLKRFKDDVTEVRTDFECGIGLGSYNDIVEGDIIETFEMREKPRV
NT seq 2868 nt NT seq  +upstreamnt  +downstreamnt
gtggccaaggtccgcgtacacgagctcgcgaaagagctcggtatcacttccaaagatgca
gtaaccaagctgcaggaactgggcgaatttgttcgctccgcctcatccaccattgaggcc
cccgtggtgcggaaactccgcaacgcattcccggctgccgccgcttcgaagtccgaagcg
cccgtagctgcacccaagtccccggccaagccggccgaatcccgtcccgcgccggctccc
ggtcctgctgcacccaaggctgcggcacccgctccggccccggcgcccgctccggcaccc
gcccccaaggcggaggcgcctgcagctcccgccgccccggcagctcccgctgccggaacg
cctgctgcaccctccaccggtgccaagccgggagcccgtcccgcgcccaaggctgagacc
cccgcacgtccgggcggcgctccgcgtcccggtggcccccgccccggcaacaaccccttc
gctacgtcccagggcatgccccgcggccgcggaggagacggcgaacgtccgccgcgcccg
ggcaacaacccgtttgccacgtcccagggcatgccccgtcccggcggcggccgcactgac
gccgaccgtcccggcggtccgcgtccggcagccggtgcaggcggaccccgccccggtgct
ccgcgtccgggcgctacgcccggtccgcgtccggcagccggtgcaggcggaccccgcccc
ggcggtccccgtccgggcgccggcggaaaccggcccacgcctggcatgatgcctaaccgc
accgagcgtccagcacctgcaggtgccggccgtcccggtggcggcggacgcggccccggc
cgtcccggcgctcccggaaccggcggtcccggtggcggcggcggtgctccggccggcggt
ggcttcggcaagggtggccgcggtcgcggtggaacccagggtgcgttcggcaagggcggc
gctggccgcggcaagcagcgcaagtcgaagcgcgcaaagcgccaggaacttgagcagatg
agcgcaccgtcgctgggtggcgtgagcgtaccccgcggcgacggcaacactgttatccgg
cttcgccgtggctcgtccatcacggactttgctgacaagatcgaggcgaaccccgccgcg
ctggttaccgtgctcttccacctcggtgaaatggcaacggcaacccagtcgctggacgag
gacacctttgcactcctcggcgaggaactcggctacaagctgcaggttgtttcgccggag
gatgaggagcgcgagctgctcagcacgttcgatattgacgtcgaagccgaactcgaggcc
gaaggtgacgaagagcttgaggcacgtcctccggtagtcaccgtcatgggccacgttgac
cacggtaagacgcgcctgctggatgccatccgtaactctgacgtcgttgccggcgagcac
ggcggcatcacgcagcacatcggtgcctaccagatcagccacgagcatgagggtgcgctg
cgcgacatcaccttcatcgataccccgggtcacgaggcgttcaccgccatgcgtgcccgt
ggtgcgaaggtcacggacatcgccatcctggttgtggcagcggacgacggcgtgatgccc
cagaccgttgaagccctcaaccacgcccaggcggccaacgtgccgatcgtcgtggccgtg
aacaagatcgacaaggaaggcgcgaacccggacaaggtcaagggccagctcaccgagtac
ggcctggttcccgaagaatacggtggcgacaccatgttcgttgaggtctctgcccgccag
aacctgaacattgacgagctgatcgacgctgtcctgctgaccgctgacgccgcgcttgac
ctgcgggccaacccggacaaggccgcccgcggtatcgccatcgaagcgaacctggacaag
ggccgcggttccgtggccaccgtcctggtgcagtccggtaccctcgctgtcggcgacacg
atcgtggcgggtacggcccacggccgcgtccgcgccatgttcgacgaggacggcgaagca
ctcgacgtggcactgccgtcccgcccggtccaggtcctcggcctgtccaacgtgccgcgc
gccggtgacaccttcctggtgaccgccgacgagcgtaccgcccgccagatcgccgagaag
cgtgaagccgctgagcgcaacgcccagctcgccaagcgccgcaagcgcatcagcctggaa
gacttcgaccaggccgtcgccgaaggcaagatcgacaccctcaacctcatcctcaagggt
gacgtgtccggtgccgtggaagccctcgaagacgcgctgctcaagatcgatgtcggcgaa
ggcgtccagctccgcgttatccaccgcggtgttggtgcgatcacgcagaacgacgtcaac
ctggcgaccgtcgacagcgccgtcatcatcggcttcaacgtcaagcctgccgagcgggtt
gccgaactggcagaccgcgaaggcgtggacatgcgcttctactccgtcatctactccgca
atcgatgacattgagctggccctcaagggcatgctcaagccggagtacgaagaggtccag
cttggcacggccgaagtccgcgaagtgttccgttcctccaagttcggcaacattgcaggc
tccatcgttcgcaccggtaccatccgacgcaacacgaaggcccgcatcagccgcggcggc
aagctcatcggcgacaacctcacggtggagacgctcaagcgcttcaaggacgacgtcacc
gaggtccgcacggacttcgagtgcggtatcggacttggctcgtacaacgacatcgttgaa
ggcgacatcatcgagaccttcgagatgcgcgagaagccgcgcgtctaa

DBGET integrated database retrieval system