KEGG   Arthrobacter sp. QXT-31: BWQ92_04570Help
Entry
BWQ92_04570       CDS       T05056                                 

Definition
(GenBank) aspartate aminotransferase family protein
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
arq  Arthrobacter sp. QXT-31
Pathway
arq00250  Alanine, aspartate and glutamate metabolism
arq00410  beta-Alanine metabolism
arq00640  Propanoate metabolism
arq00650  Butanoate metabolism
arq01100  Metabolic pathways
arq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:arq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BWQ92_04570
   00650 Butanoate metabolism
    BWQ92_04570
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BWQ92_04570
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BWQ92_04570
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:arq01007]
    BWQ92_04570
Enzymes [BR:arq01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BWQ92_04570
Amino acid related enzymes [BR:arq01007]
 Aminotransferase (transaminase)
  Class III
   BWQ92_04570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: APX01098
UniProt: A0A1P8LZA3
LinkDB All DBs
Position
1003523..1004776
Genome map
AA seq 417 aa AA seqDB search
MATLSPLLKQATPVVVDHALGSWIHATDGKKYLDFTTGIGVTSTGHCHPDVVAAAREQVG
KIVHAQYTTVMHKPLLELTERLGDFLPSGLDSVFYATSGSEAVEASVRLARMATGRPNII
SFQGGFHGRTVGAASLTTAGTKFRSGFSPLMGGVHIAPFPHSYRYGWDEETAVNFALKEL
DHLFLSISSPADTAGFIIEPVLGDGGYIPTPPAFLQGLRERADRHGIVLIVDEVQAGVGR
TGKFWGHDWAGIRPDVVITAKGLASGFPISAIAASAELMGKAWPGSQGGTYGGNAVAAAA
GVATLGVIERENLVENALLRGDELRTGLEGLKADFAGIGNVRGRGLMQGIEFTTADNVPD
AATALAVQQEAIKEELLLLTCGPHGNVIRIIPPLNVSSDEIQAGLTRFTQALKTATS
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggcaactctcagccccctcctcaagcaggcaactccggtggtcgtagaccatgctctc
ggcagctggatccacgccaccgacggtaaaaagtacctcgatttcaccaccggaatcggc
gttacgagtacgggacactgccaccccgacgtcgtagcggcagcccgcgaacaggtgggc
aagattgtccatgcccagtacaccaccgtgatgcacaagccattgcttgagctcaccgaa
aggctgggagacttcctgccctcggggctggacagcgttttctacgccacctccggctcc
gaggcagtggaagcctccgtccgccttgcgcggatggccacgggccggcccaacatcatc
tccttccagggcggctttcacggcaggacggtgggcgctgcctcccttaccaccgcaggc
accaaattccggtccggcttctcccccctcatgggcggggtgcacatcgcgcccttcccg
cattcgtaccggtacggctgggacgaggaaacagcagtcaacttcgcactgaaggaactg
gaccacctcttcctcagcatcagcagcccagcagacactgccggcttcatcatcgaaccc
gtcctcggcgacggcggctacatccccactcccccggcgttcctgcagggcctgcgggaa
cgggctgaccggcacggcatcgtgctcatcgtggacgaagtccaggctggcgtgggccgc
accggaaagttctggggacacgactgggcagggattcgccccgacgtcgtcattaccgcc
aagggcctggcgagcggtttcccgatctcggccattgccgcctcggcggaactgatgggc
aaggcctggcccggctcccagggcggcacctacggcggaaacgccgtcgccgccgcggcc
ggcgtggcgaccctcggcgtcattgaacgcgaaaacctggtggagaacgccctgctccgc
ggcgatgagctgcgcaccgggctggaaggcctcaaggcagactttgcgggaatcggaaac
gtccgcggccgcggcctcatgcaaggcatcgaattcaccacggcggacaacgtccctgat
gccgctaccgccctggccgtccagcaggaagccatcaaggaagagctcctcctgctcacc
tgcgggccgcacggcaacgtcatccgcatcatcccgcccctcaacgtcagcagcgacgag
atccaggcagggctgaccaggttcacccaggcgctgaagacggccacctcctaa

DBGET integrated database retrieval system