KEGG   Arthrobacter sp. QXT-31: BWQ92_07170Help
Entry
BWQ92_07170       CDS       T05056                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
arq  Arthrobacter sp. QXT-31
Pathway
arq00620  Pyruvate metabolism
arq00680  Methane metabolism
arq01100  Metabolic pathways
arq01120  Microbial metabolism in diverse environments
arq01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:arq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BWQ92_07170
  09102 Energy metabolism
   00680 Methane metabolism
    BWQ92_07170
Enzymes [BR:arq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BWQ92_07170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 Se-cys_synth_N SPATA1_C
Motif
Other DBs
NCBI-ProteinID: APX01522
UniProt: A0A1P8M0G8
LinkDB All DBs
Position
complement(1595977..1598787)
Genome map
AA seq 936 aa AA seqDB search
MADTAMNSETDLAAELRADVRRVSTLLGESLVRQHGPELLDLVEQVRLLTKESKEAARGG
ADATGPWSAHDVVAQVRELLASLPLEQATDLVRAFAFYFHLANAAEQVHRVRGLRTRQEK
DGWLAKAVEDIAGQAGPAVLQEVVNELDVRPIFTAHPTEASRRSVLDKIRKLSDVLAQPT
EEGTSARRRQDRQLSEMIDQMWQTDELRQVRPTPVDEARNAIYYLNSILTDALPEMLTDF
SELLGEHGVALPAKNAPIRFGSWIGGDRDGNPNVTAAVTHDILQLQNQNAVRISIAMIDE
LISVLSNSTALAGADQALLDSIDADLAKLPGLDRRILELNAQEPYRLKLTCIKAKLINTG
KRVAAGSKHEAGRDYTSTEELIGELELLELSLRNHSASLAADGALARVRRAIASFGLHLA
TLDIREHADHHHDAVGQLMDRLGGPGIRYAELTRDERLEVLSAELASRRPLSGHPIRLDG
AADGTYDVFREIRRALRTYGPDVIETYIISMTRGADDVLAAAVLAREAGLVSLFGDAPYA
KIGFAPLLETVEELRASAEIVDRLLSDSSYRELVRLRGDVQEVMLGYSDSNKESGVMTSQ
WEIHKTQRKLRDIATKHGVRVRLFHGRGGSVGRGGGPTYDAIMAQPNGVLEGEIKFTEQG
EVISDKYSLPELARENLELSLAAVLQGSALHRTPRTSDDQRERFGHVMETISDAAFARYR
SLIDHPDLPAYFLASTPVEQLGSLNIGSRPSKRPDSGAGLGGLRAIPWVFGWTQSRQIVP
GWFGVGSGLKAAREAGNSAQLVEMMQGWHFFRSVLSNVEMTLAKTDMEIAGYYVDTLVPE
ELHHLFRAIRDEYELTVSEIQNLTGENVLLDAQPTLKRSLEIRDQYLDPISYLQVELLRR
VRAEGAGMSKGEIDERLQRAMLITVNGVAAGLRNTG
NT seq 2811 nt NT seq  +upstreamnt  +downstreamnt
atggctgacactgcaatgaattccgaaacagatctcgccgccgaactccgcgcggacgtc
cgccgcgtctccaccctgctgggcgaatccctggtccgtcagcacgggcccgagctcctc
gacctggtggagcaggtccgcctcctgacgaaggaatccaaggaggccgcccggggcggc
gcggacgccaccggcccgtggagcgcgcacgacgtcgttgcccaggtccgcgagctgctc
gcctccctgccgcttgagcaggcgaccgacctggtccgcgccttcgccttctacttccac
ctcgccaacgccgccgagcaggtccaccgggtccgcggcctgcgcacccggcaggagaag
gacggctggctcgccaaagccgttgaggacatcgcaggccaggccggcccggcggtgctg
caggaagtggtcaacgaactggatgtgcgcccgatcttcaccgcgcaccccaccgaggcg
tcacgccgttcggtgctggacaagatccgcaagctctccgacgtgctggcccagcccacc
gaggaaggcaccagcgcccggcgccggcaggaccgccagctgtccgaaatgatcgaccag
atgtggcagacggacgagctgcgccaggtccggcccacgcccgtagatgaggcccgcaac
gccatctactacctcaacagcatcctgacggacgcgctgccggagatgctcacggatttc
tcggagctcctcggtgagcacggggttgccctgccggccaagaacgcgcccatccggttc
ggctcatggatcggcggcgaccgcgacggcaacccgaacgtcaccgcggccgtgacccac
gacatcctgcagctccagaaccagaacgcggtgcggatcagcatcgccatgatcgacgag
ctcatctccgtcctgtccaactcgaccgcgctcgccggtgccgaccaggcgctcctggac
tccatcgacgcagacctcgcgaaactgcccggactggaccgccgcatcctggaactcaac
gcccaggagccctaccggctgaagctgacctgcatcaaggccaagctcatcaacaccgga
aagcgggtcgccgccggatccaagcacgaggcggggcgggactacacctccaccgaggaa
ctcatcggcgaactcgagctgctggaactgtccttgcgcaaccactcggcgtccctcgcg
gcggatggcgcgctggcacgtgtccgccgggccatcgcctccttcggcctgcatctggcc
accctcgacatccgtgagcatgccgaccatcaccatgacgccgtcgggcagctcatggac
cggcttggcggtccaggcatccggtatgccgagctgacccgggacgagcgcctcgaggtc
ctgagcgcggagcttgcctcccgccgtccgctgtccggccacccgatcaggctcgacggc
gccgctgacggcacatacgacgtcttccgggagatccgccgcgccctgcgcacgtacggt
ccggacgtcatcgagacctacatcatttccatgacccgtggtgctgacgacgtcctggcc
gccgctgtgctggcgcgcgaggccggcctggtcagcctcttcggcgacgccccgtacgcc
aagatcggttttgcgccgctgctggaaaccgtcgaggaactgcgtgcgtccgcggagatt
gttgacaggctgctgtccgactcctcctaccgcgaactggtccggctgcgcggggacgtc
caggaggtcatgctcggctactcggactccaacaaggaatccggcgtgatgaccagccag
tgggaaatccacaagacccagcgcaagctgcgcgacatcgccaccaagcacggggtccgg
gtgcgcctgttccacggccgcggcggttccgtgggccgcggcggcgggcccacctacgac
gccatcatggcgcagccgaacggtgtcctcgagggggaaatcaagttcaccgaacagggc
gaggtcatctcggacaagtactccctgccggagctggcccgggaaaacctggagctttcg
ctcgccgccgtgctgcagggctctgcgctgcaccgcacgccgcgcacctcggacgaccag
cgcgagcgcttcggccatgtcatggagaccatctccgacgctgcctttgcccgctaccgc
agcctcatcgaccacccggacctgccggcatacttcctggcctcgacgccggtggagcag
ctcggctctctcaacatcggctcacgcccgtccaagcgaccggactcaggtgcggggctg
ggcggcctgcgcgccattccgtgggtgttcggctggacgcagtcgcggcagattgtgccg
ggctggttcggcgtggggtccgggctgaaggcggcacgcgaagccggcaactccgcccag
ctcgtggagatgatgcagggctggcatttcttccgctcggtgctgtccaacgtggaaatg
accctcgccaagacggacatggagatcgcgggctattacgtggacaccctggtcccggag
gagctgcaccacctcttccgtgccatccgtgacgaatacgagctcaccgtctccgagatc
cagaacctcaccggcgagaacgtgctcctggacgcccagcccacgctgaagcgctcactg
gaaatccgcgaccagtacctcgacccgatcagctacctgcaggtggaactgctccgccgc
gtgcgggccgagggtgccggcatgtccaagggcgagatcgacgagcgcctccaacgggcc
atgctgatcaccgtcaacggtgtggcagcaggcctccgcaacaccgggtag

DBGET integrated database retrieval system