KEGG   Arthrobacter sp. QXT-31: BWQ92_08275Help
Entry
BWQ92_08275       CDS       T05056                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
arq  Arthrobacter sp. QXT-31
Pathway
arq03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:arq00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    BWQ92_08275
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:arq03400]
    BWQ92_08275
Enzymes [BR:arq01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BWQ92_08275
DNA repair and recombination proteins [BR:arq03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     BWQ92_08275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M LigD_N DNA_ligase_A_C DNA_primase_S DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: APX01705
UniProt: A0A1P8M110
LinkDB All DBs
Position
1827167..1829746
Genome map
AA seq 859 aa AA seqDB search
MAGGKERVRVGGRELTLTNLDKIMYPATGTTKADVIAYYAAVAPVLIPAARNRPVTRKRW
VHGVGTEDNPGEVFFQKNLDESAPGWVPRAAITHKTNTNYYPLLNDPATLTWLAQIASLE
IHVPQWTVDSHGRSLPPDRLVLDLDPGEGAGLPECVEVAKLARTILQDVGLDPVPVTSGS
KGIHLYAVLKGTQSSDEVSAFARELARALEADHPDIAVSDMKKALRTGKVLVDWSQNNAA
KTTIVPYSLRGRLHPTVAAPRTWRELGSPSLKHLDYEEVMRRVAAGKDPFAPISAVTGHP
SPAHPSPVHTRPAHTAADGPRGGGHADPRLNKYRSLRDQGKTPEPFTAEEHHAAKANGAS
AQAGKEIFVIQEHHASRLHYDFRLEHEGVLVSWALPKGVPESADKNHLAVQTEDHPMDYA
DFEGDIPKGEYGAGSVSIWDKGVYELEKWVNGKEVIATLTGQEGGGLGGTRKFALIHTGK
GQGEESQWLIHLMDRVTGVRKKQVGTKGPAGPARAAAHTRSAPAQAAPAAAPRGVSALQE
DPAPMLASAGTLADLHGSEWLFELKWDGIRALVVADGDRIRLLSRNGNDMSASYPEFTDR
SCWPPQDFIADGEIIAVGPSGRPDFGLLQGRMKLTRPGDVKRARATIPVRMMLFDLLADG
GDDLRKLPLRKRRERLADFFEPGECPVELSETLDDRVEHILESARELGLEGVMAKRADSR
YVSGQRTHTWIKLKIEQTQEVVVGGWRPGKGDRSNTVGYLLVGIPEGKTLRYVGRVGSGF
SMRELEELRKRLEGLAQKTRPFDDVPSADAADARWVKPDLVGEVTFGEWTGSGKLRHPVW
RGWRLDKEPAEVVVESQGL
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atggccggcggtaaggaacgcgtaagggtcggtggccgcgaactgaccctgaccaacctc
gacaagataatgtatcccgccaccggcaccaccaaggcggacgtcatcgcctactacgct
gcggtggccccggttctcattcccgctgccagaaaccgcccggtgacccgcaagcgatgg
gtgcacggagtaggaactgaggacaacccgggcgaggtgttcttccagaagaacctggac
gaatcggcgcccggctgggtgccccgtgccgccatcacgcacaagaccaacaccaactac
tatccgctgcttaatgatccggccaccctcacctggctggcgcagatcgcctcgctggag
atccacgtgccgcagtggacggtggactcccacggacgttctttgccgcccgaccggctg
gtcctggacctcgatcccggggaaggcgcgggcctgcccgaatgcgtggaggtggccaaa
ctggcgcggaccatcctgcaggacgtggggcttgaccccgttccggtcaccagcggcagc
aagggcatccacctgtatgcagtcctcaaggggacgcagagctcggatgaggtttccgcc
ttcgcgcgggaactggcccgcgcactggaggccgaccatcccgacattgccgtcagcgac
atgaagaaggcccttcggacggggaaggtcctggtcgactggagccagaacaacgcagcg
aagaccacgatcgttccgtactcgctccgcgggcggctgcaccccacggtggcggcgccg
cggacctggcgggagctgggttcgccgtcgctgaagcacctggactacgaggaggtcatg
cgccgggtggcggccggcaaggaccccttcgcgccgatcagtgcggtcaccggccatccc
agcccagcccaccccagccccgtccacaccaggcccgcccacactgctgccgacggtccg
cgcgggggaggccatgccgatccccggctgaacaagtaccggtccctgcgcgaccaagga
aaaacgcccgagccgttcaccgccgaagaacaccacgcggcgaaagccaacggcgcctcc
gcgcaggcgggcaaggagatcttcgtaatccaggagcatcacgccagccggctgcattac
gacttccggctggagcacgagggggttctggtctcctgggccctgcccaagggggtgccc
gagtcagcggacaagaaccacttggccgtacagaccgaagaccaccccatggactacgcc
gactttgagggtgacatccccaagggcgaatacggggcgggcagcgtgagcatctgggac
aagggcgtctacgagctcgaaaagtgggtgaacggaaaggaagtcatagccacactgacc
ggccaggagggcggcgggctgggcggcaccaggaagttcgccctgatccatacggggaag
gggcagggcgaggaatcccagtggctcatccatctgatggacagggtcaccggcgtacgg
aaaaagcaggtcggcaccaagggaccggcgggcccggcccgcgctgccgcgcacacccgc
tccgcgcccgctcaggcggctccggccgcggccccaagaggtgtcagcgcccttcaggag
gacccggcccccatgctcgcctcggcaggcaccctggcggatctgcacggcagcgagtgg
ctcttcgaactcaagtgggacgggatccgcgcgctcgtggtggcggacggcgaccggatc
aggctcctgagccgcaatggcaacgacatgtcggccagctatccggaattcacggaccgg
agctgctggccgccgcaggacttcatcgctgacggtgagatcatcgccgtcgggccgtcc
ggccggccggacttcgggctcctgcagggaagaatgaagctgaccaggccgggcgacgtg
aagcgggcgcgtgccaccatcccggtgcggatgatgctcttcgacctcctggccgacggc
ggcgatgaccttcgcaagctgcccctgaggaagcggcgggagcggctggctgacttcttc
gaacccggcgagtgcccggtggaactgtcggagaccctggacgaccgggtggaacacatc
ctggaaagcgcccgggaactgggcttggaaggcgtgatggccaagcgggcggacagccgc
tatgtgagcgggcagcggacccacacatggatcaagctcaagatcgaacagacacaggaa
gtggtggtgggcggctggcggcccggcaagggcgaccggtccaacaccgtgggatacctc
cttgtgggcattccggagggcaagactctgcggtatgtgggccgtgtgggaagcggcttc
agcatgcgtgaactggaggagttgcggaaaaggctggaggggctggcccaaaagacgcgg
cccttcgatgacgtcccctcggcagacgcggcagacgcccgctgggtcaagcccgacctg
gtgggcgaggtgactttcggtgagtggaccgggagcggcaagctccgccaccctgtatgg
cgcggctggcggctggacaaggaaccggcggaggttgtggtggagtcccagggcctatga

DBGET integrated database retrieval system