KEGG   Arthrobacter sp. QXT-31: BWQ92_14330Help
Entry
BWQ92_14330       CDS       T05056                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
arq  Arthrobacter sp. QXT-31
Pathway
arq00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:arq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    BWQ92_14330
Enzymes [BR:arq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BWQ92_14330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Glyco_hydro_14
Motif
Other DBs
NCBI-ProteinID: APX02730
UniProt: A0A1P8M3X2
LinkDB All DBs
Position
complement(3172111..3174144)
Genome map
AA seq 677 aa AA seqDB search
MPEHQASSRAPGWNSAPRWNSGPGLAFGGDYNPEQWPADVRREDIGLMKEAGVTLLSVAI
FSWALLEPREGEYDFGWLDEVLDSLDGAGIKVALATATAAPPAWLVRRHPGVLPVTAEGT
VLERGSRRHYSPSSAAYRRYATGITRKLAERYKDHPALALWHVDNELGCHVSEFYGDEDA
AAFRRWLEQRYGSVEALNEAWGTAFWSQHYASFQEIIPPRAAPAILNPTQRLDFQRFSSW
ALLDYYRCLLAVIREVTPDIPATTNLMVSSATKSMDYFHWAGALDVVANDHYLVAADRER
EIELAFSADLTRGIAGNRPWILMEHSTSAVNWQPRNQPKMPGEMLRNSLAHVARGADAVM
FFQWRQSVAGAEKFHSAMVPHGGRDTRVWREVVALGEALGKLGAVKGSTVESRVAIVFDY
EAWWASELDSHPSMDVKYLDLIREFHRSLFLRGVGVDFVHPAADLTGYDLVLVCTLYCVT
DAAAANIVGAAEAGATVLVSYFSGIVDERDHVRLGGYPGAFRELLGIRTEEFHPLLEDYQ
VALSDGTTGRVWSEHVHAEGAETLATFTGYPLAGVPALTRRATGSGAAWYLATLPDRDGI
ENLLDKLLAEAGVAAVAEAAAGVELTRRVTADGRRFLFAINHGRADAAVKADGEELLGGG
RFAGFVPGGGAAVIAED
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagcaccaagcctcttcccgcgctcccggatggaacagcgctccccgatggaac
agtggccccggcctggcattcggcggtgactacaaccccgagcagtggccggctgacgtg
cggcgggaggacatcggcctcatgaaggaggccggcgtaaccctcctcagcgtggccatc
ttttcctgggcgctcctggagccccgcgaaggggagtacgacttcggctggctggacgag
gtgctggacagcctggacggcgccggcatcaaggttgccctcgccacggcgacggccgct
cccccggcctggctggtccggaggcatccgggggtcctgccggtaaccgccgagggcacc
gtcctggaacgtggctcccggcggcactactcgccgtcgtccgctgcttaccgccggtac
gccactggcatcacccggaagctggccgaacggtacaaggaccatccggccctggcgctg
tggcacgtggacaacgagctgggctgccacgtgtcagagttttacggcgacgaggacgca
gcggcgttccggcgctggctggagcagcgctatggcagcgtcgaggcgctgaacgaggcc
tggggcacggctttctggtcccagcactatgcgtcattccaggagatcattccgccccgg
gccgcccccgccatcctcaacccgacgcagcggctggacttccagcggttcagctcctgg
gcgctgctggactactaccgctgcctgctggccgtgatccgggaagtgaccccggacatt
ccggccaccaccaacctcatggtgtccagcgccaccaagtccatggactacttccactgg
gccggggccctggacgtggtggccaacgaccattacctggtggccgcggaccgggaacgg
gaaatcgaactggcgttcagcgcggacctcacccgcggtattgcgggcaacaggccatgg
atcctgatggagcattcgacgtcggccgtgaactggcagccgcgcaaccagccaaagatg
cccggcgagatgctccgcaattcgctggcgcacgtggcccgcggcgccgacgccgtcatg
ttcttccagtggcggcagagcgttgccggcgccgagaaattccactcggccatggtgccg
cacggcggccgggacacgcgggtgtggcgggaagtggtggccctgggtgaagcccttggc
aaactcggggcggtcaagggctccaccgtggaatcccgggtggccattgtcttcgactac
gaggcgtggtgggcgagcgaactggactcgcacccaagcatggatgtgaagtacctcgac
ctgatccgcgaattccaccgttcgctgttcctgcgcggcgtcggcgtggacttcgtgcat
cccgccgcggacctcaccggctacgacctggtcctggtctgcacgctctactgcgtcacc
gacgccgccgcggccaacatcgtcggcgccgccgaagccggtgccacggtgctggtcagc
tacttcagcggcatcgtcgacgaacgcgaccacgtccggctgggcggctacccgggcgcc
ttccgcgaactgctgggaatccggacggaggagttccacccgctgctcgaggattaccag
gttgccctgagcgacggcaccacgggccgggtctggagcgagcacgtgcatgccgagggc
gcggaaaccctggccaccttcaccggctacccgctcgccggcgtgccggcactcaccaga
agggccaccggcagcggcgcggcctggtatctggcaaccctccccgaccgggacggcatc
gaaaacctcctggacaagctcctggccgaagcgggagtggcagccgtcgcggaggccgct
gccggcgtcgagctcaccaggcgggtcaccgccgacgggcgccgcttcctcttcgccatc
aaccacggccgggcggatgcggcagtgaaggccgacggcgaagagctgttgggcggcgga
cgtttcgccggcttcgtgcccggcggaggggcggcggtgatcgccgaggactga

DBGET integrated database retrieval system