KEGG   Arthrobacter sp. QXT-31: BWQ92_15985Help
Entry
BWQ92_15985       CDS       T05056                                 

Definition
(GenBank) alcohol dehydrogenase AdhP
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
arq  Arthrobacter sp. QXT-31
Pathway
arq00010  Glycolysis / Gluconeogenesis
arq00071  Fatty acid degradation
arq00350  Tyrosine metabolism
arq00625  Chloroalkane and chloroalkene degradation
arq00626  Naphthalene degradation
arq01100  Metabolic pathways
arq01110  Biosynthesis of secondary metabolites
arq01120  Microbial metabolism in diverse environments
arq01130  Biosynthesis of antibiotics
arq01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:arq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BWQ92_15985
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BWQ92_15985
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    BWQ92_15985
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BWQ92_15985
   00626 Naphthalene degradation
    BWQ92_15985
Enzymes [BR:arq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BWQ92_15985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: APX04577
UniProt: A0A1P8M8T4
LinkDB All DBs
Position
3532766..3533776
Genome map
AA seq 336 aa AA seqDB search
MQAAVVSEFAKDLQIQDIPVPAPGRGQALVKLITSGVCHTDLHAAEGDWPVKPSPPFVPG
HEGVGEVVALGEGVTDLAVGDLVGNAWLWSACGDCQYCRTGWETLCESQKNAGYSVDGSF
GEYMLVDSRFAARIPAGSDPVEVAPVLCAGVTVYKGLKMTEARPGEWVTISGIGGLGHIA
VQYAVAMGLRVAAVDIADDKLALARKHGAELTVNALHEDPAEVIQRETGGCSGVLVTAVH
PSAFGQAIGMARRGGTIVFNGLPPGDFPAPIFEIVLKGLTVRGSIVGTRQDLEEALDFYA
QGKIHPTVSTRELSEVNAVFDEMKHAKIDGRVVLTF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcagccgtagtatccgaatttgccaaggacctccagatccaggacatacctgtc
cccgcgcccggccgcggccaggcactggtcaaactcatcaccagcggtgtctgccacacc
gacctccacgccgccgaaggggactggccggtcaaaccgtcgcctccgttcgtgcccggg
cacgaaggcgtgggcgaggtggtggccctcggcgagggggtgaccgacctcgctgtcggg
gatctggtgggcaacgcctggctgtggtctgcctgcggcgactgccagtactgccgcaca
ggctgggaaacgctgtgcgagtcccagaagaacgccggctacagcgtggacggctccttc
ggcgagtacatgctggtggacagccgctttgcggcccggattccggcgggctcggacccg
gtggaggttgccccggtgctctgtgccggtgtcaccgtctacaaggggctgaaaatgacc
gaggccaggccgggggagtgggtcaccatctccggcatcggcggactggggcacatcgcc
gtccagtacgccgtcgccatgggcctgcgcgttgccgccgtcgacatcgcggacgacaaa
ctcgccctcgccaggaagcacggcgcagagctcaccgtcaacgctctccacgaggacccg
gcggaggtcatccagcgggaaaccggaggctgcagcggagtcctggtcacggcggtgcac
ccctcggccttcggccaggccatcggcatggcccgccgcggcggcaccatcgtgttcaac
ggcctgccgccgggcgacttcccggcaccgatcttcgagatcgtgctcaagggcctgacc
gtccgcggctccatcgtgggcacccggcaggacctggaggaagcgctggacttctacgcg
cagggcaagatccaccccacggtgtccacacgggaactctccgaggtcaacgccgtcttc
gacgagatgaagcacgcgaagatcgacggccgcgtggtgctgacgttctga

DBGET integrated database retrieval system