KEGG   Arthrobacter sp. QXT-31: BWQ92_16380Help
Entry
BWQ92_16380       CDS       T05056                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
arq  Arthrobacter sp. QXT-31
Pathway
arq00010  Glycolysis / Gluconeogenesis
arq00030  Pentose phosphate pathway
arq00051  Fructose and mannose metabolism
arq00052  Galactose metabolism
arq00680  Methane metabolism
arq01100  Metabolic pathways
arq01110  Biosynthesis of secondary metabolites
arq01120  Microbial metabolism in diverse environments
arq01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:arq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BWQ92_16380
   00030 Pentose phosphate pathway
    BWQ92_16380
   00051 Fructose and mannose metabolism
    BWQ92_16380
   00052 Galactose metabolism
    BWQ92_16380
  Energy metabolism
   00680 Methane metabolism
    BWQ92_16380
Enzymes [BR:arq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BWQ92_16380
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     BWQ92_16380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: APX03075
UniProt: A0A1P8M511
LinkDB All DBs
Position
complement(3615471..3616496)
Genome map
AA seq 341 aa AA seqDB search
MKIGILTSGGDCPGLNAVIRGAVLKGIAIHGHEFVGFLDGWRGVVEGDIIPIPRTLVRGI
AKQGGTILGTSRTNPFENGGGPDVIKAHMDRLGIDAIIAIGGEGTLAAAKRLTDAGLKIV
GVPKTVDNDLDATDYTFGFDTAVQIATEAIDRLRTTGESHHRCMIAEVMGRHVGWIALHA
GMAAGAHAILIPEQKVSIEQITKWVTEAHDRGRAPLVVVAEGFVPEHMESPHSERGLDTF
GRPRLGGIADQLAPEIEARTGIETRATILGHIQRGGVPSAFDRVLATRLGMAAIDSVTDG
RWGTMVSLNGTDIDHVGFDAALGKLKTVPQHRYDEAAVLFG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattggaatcctcaccagcggcggcgactgccccggactgaacgccgttatccgc
ggcgccgtcctcaaaggcattgccatccacggccacgaattcgtggggttcctcgacggt
tggcgcggagtggttgagggtgacatcatccccattccgcgtacgcttgtccgcggtatt
gccaagcagggcggcaccatcctgggcacctcgcgcaccaacccgttcgagaacggaggc
ggaccggacgtcatcaaggcacacatggaccgcctggggatcgacgccatcatcgccatc
ggcggcgaaggaaccctcgccgcggcgaagcgcctcaccgacgccggcctgaagatcgtc
ggcgtcccgaagaccgtggacaacgacctcgacgccaccgactacaccttcggcttcgac
accgccgtccagatcgccaccgaggcaatcgaccggctgcggaccaccggcgaatcccac
caccgctgcatgatcgccgaggtcatgggccggcacgtcggctggatcgccctgcatgcc
ggcatggccgcaggcgcccacgccatcctcatcccggagcagaaagtcagcatcgaacag
atcaccaaatgggtcaccgaggcccatgaccgtggccgtgcgccgctggtcgtggtggcc
gaaggtttcgtcccggaacacatggagtcaccgcactccgagcgcggcctggacaccttc
ggccggccccgcctgggcggcatcgccgaccagctggccccggagatcgaagcccgcacg
ggcatcgaaacccgcgccaccatcctgggccacatccagcgcggcggcgtcccgtccgca
ttcgaccgcgtcctggccacccgcctcggcatggcggccatcgactccgtcaccgacggc
cgctggggcaccatggtgtcgctgaacggcacggacatcgaccatgtgggcttcgatgcc
gccctgggcaagctcaagacggttccgcagcaccgctacgacgaagccgccgtcctcttc
ggctga

DBGET integrated database retrieval system