KEGG   Arthrobacter sp. QXT-31: BWQ92_22390Help
Entry
BWQ92_22390       CDS       T05056                                 

Definition
(GenBank) bi-functional transferase/deacetylase
Organism
arq  Arthrobacter sp. QXT-31
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_tranf_2_3 Glycos_transf_2 Polysacc_deac_1 Glyco_trans_2_3 Glyco_transf_21 Chitin_synth_2 Glyco_tranf_2_2 Glyco_tranf_2_4 BNR_3
Motif
Other DBs
NCBI-ProteinID: APX04115
UniProt: A0A1P8M831
LinkDB All DBs
Position
complement(4900918..4903059)
Genome map
AA seq 713 aa AA seqDB search
MSRHRQLRDAAAVRAHWLVLSAVLFAISFALVVQGYMHHLGGIGDDSVPVSGSAARVPAS
VSSGGPVIDARGGNVRTVAPQDRTLALTFDDGPDPVWTPQILDVLKKHKVQATFFMVGSA
AVENPDLARRIVDEGHEIGVHTLTHADLGSSPDWRRQLELQGAQQVIMGVTGQAASLLRP
PFSSGNTAVNDSTWSSIRAAADEGYLTVLSTKDSQDWKQPGAASIERNLALSGNRGQVLL
MHDSGGDRSQTVTALDSFLSRMDAQGYRVTTVGKAIGVSSTREATPVEQASGTAFVWGIR
LSDWLVTAISWALVASGVVTFIRAVLVMGAAVRHRRQARGKQAASRAPGGTAITEPVTVI
VPAYNEAAGIEAAVRSIAASTHPVEIIVVDDGSTDGTADIVEALGLPGVTLIRKENGGKP
SALNAGLQAATHDLVVMVDGDTVFEPDSVRALIQPFADPRVGAISGNTKVANRGGILGAW
QHIEYVVGFNLDRRLFDVAECMPTVPGAIGGFRRDALLRVGGVSDDTLAEDTDLTMALCR
DGWRVVYQDDARAWTEAPATLGALWKQRYRWCYGTLQAMWKHRGAIVQGGQAGKLGRRGL
GYLLVLQVLLPLFAPVVDVFALYGLIFLDPVRIALLWLVFLVVQVLMAAYAFRLDKERLG
PLWTLPLQQFVYRQLMYLVVIQSVVTALAGVHLRWHRMERYGSLRVPPAARNS
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
gtgagccggcaccgtcaactaagggacgccgccgcggtacgcgcgcactggctggttctt
tccgccgttctcttcgccatttcattcgctttggtggtgcaggggtatatgcatcacctc
ggcggcatcggtgatgactccgttccggtctccggttcagctgcccgagtgcccgcctcc
gtttccagcgggggaccggtcatagacgcccgcggcgggaacgtccgtaccgtggctccg
caggaccgcacgctggcgctgacgttcgacgacggcccggacccggtttggaccccgcag
atcctcgatgtcctgaagaagcacaaggtgcaggccacgtttttcatggtcggctcggca
gcggtcgagaacccggaccttgcccgccgcattgtcgatgaaggccacgagatcggggtc
cataccctcacgcacgctgaccttggcagttcaccggactggcgccgccaactggaactg
cagggggcccagcaggtgatcatgggcgtgaccgggcaggcagcgtctctgctgcgcccg
ccgttcagttccggaaacaccgccgtcaatgactcgacctggtcctctatccgtgctgct
gctgacgagggatatctcaccgtcctgagcacgaaggacagtcaggactggaagcagcca
ggggctgcgtccattgagcggaaccttgctctctcgggaaaccggggccaggtgctgctc
atgcacgacagcggcggtgaccgcagccagactgtcacggcactggattcatttctctcc
cggatggacgcgcagggctaccgggtgaccacggtcggcaaagccattggcgtgtccagt
acccgggaggccacacccgtcgaacaagccagcggaactgccttcgtctggggcatccgg
ctcagtgattggctggtgaccgcaatttcgtgggcgctggtggcaagcggggttgtgacc
ttcatccgggccgtcctcgtcatgggcgccgcagtgcggcaccggcgccaggcacggggc
aagcaggcggccagccgcgcccctggtggcacggcaatcacggagcccgtgacggtcatc
gttccggcttacaacgaagcggcagggatcgaggccgccgtgcggtccatcgccgcctcg
acccatcccgtggagatcattgtcgtggacgatggctcaacggacggcaccgcggacatc
gttgaggcccttggactcccaggcgtgacgctcatccgcaaggaaaacggcggcaagccg
tcggcgcttaatgccgggctgcaggccgctacccacgacctcgttgtcatggtggacggc
gatactgtttttgagcccgactccgtccgggcgctcattcagccgtttgccgatcccagg
gtgggcgcaatctcggggaacacgaaagtggccaaccgcggcgggattctcggggcatgg
cagcacattgaatatgtggtgggcttcaacctggaccgccgcctgttcgacgtcgccgaa
tgcatgcctaccgtgccgggggccatcggcggcttccgccgcgacgcgctgctccgcgtc
ggtggcgtaagcgatgacaccctcgccgaggacacggacctgaccatggcgctctgccgc
gacggctggcgcgtcgtgtaccaggacgacgcccgggcctggaccgaggctccagcgacg
ctcggcgcactgtggaagcagcggtaccgctggtgctacgggacactgcaggccatgtgg
aagcaccgcggcgcgatcgtgcagggaggacaggccggcaagctcgggcgccggggactt
ggctacctcctcgtgctccaggtgcttcttccgctgttcgcgccggtcgtggacgtcttc
gccctctacgggctgatcttcctcgacccggtgcgcatcgccctcctgtggctggtcttc
ctggtggttcaggtgctgatggccgcctacgcgttccggctcgacaaggaacgcctgggc
ccgctgtggacgctcccgctccagcagttcgtctaccgccagctgatgtacctggtggtc
atccagtcggtcgtcacggcactggcaggcgtgcacctgcgctggcaccgcatggaacgg
tacgggagcctgcgcgtcccgccggcggcccggaacagctga

DBGET integrated database retrieval system