KEGG   Arthrobacter sp. Rue61a: ARUE_c02810Help
Entry
ARUE_c02810       CDS       T02215                                 

Definition
(GenBank) putative DNA ligase-like protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
arr03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:arr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    ARUE_c02810
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:arr03400]
    ARUE_c02810
Enzymes [BR:arr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     ARUE_c02810
DNA repair and recombination proteins [BR:arr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     ARUE_c02810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M LigD_N DNA_ligase_A_C DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AFR27221
UniProt: J7LQT2
LinkDB All DBs
Position
complement(295607..298165)
Genome map
AA seq 852 aa AA seqDB search
MAGKQQERVNVEGHELTLTNLNKIIYPETGTTKAEVLEYYAAVAPFLIPAAANRPVTRKR
WVNGVGTAENPGQVFFQKNLEDSAPKWIPRAAIQHSDHTNVYPMVNNLATLTWMAQIASL
EIHVPQWQVDPSGKPLRPDRFVLDLDPGPGAGLSECVEVAKLARSILQDMGMDPVPVTSG
SKGIHLYTGLDGTLKSEQVSAFAKELARALESDHPELVVSDMKKSLRHGKVLVDWSQNSG
NKTTIVPYSLRGKAHPTVAAPRTWRELSSPSLEHLDYVAVMKRVKTGKDHFAPISERHLP
PHGEDENDDDGTAGSSSGTGRSRERVVTVENRLAKYVGMRDPGKTPEPFPSSSAVSASPQ
SAGSASDQPKPGDPPPPGGIFVIQEHHARRYHLDLRLEHHGVLASWALPRGIPESPDRNN
LAVHTEDHPMEYANFAGVIPKGEYGAGTMTIWDRGEYTCEKWRDGKEVIATLTGEPGGGL
GGTKRFALINTGQNWLIHLMKEQPGGRRGAQSAAKAAAPKSAPTQAPAPRPMPNYTPMLA
TSGTTADLRGDDWLYELKWDGIRAIITGTEGRIRLMSRNGNDLTAAYPELTDRACWPDGD
FVADGEIVALGKGSRPDFGRLQLRMNLVKAADIERARATVPVQLMLFDLLYDDGTDLSGL
PFHERRERLSGFADRLRGGCPLHLSAVLDHDVEDLMTSAAELGLEGVMAKKADSRYVIGR
RSRSWIKLKLEQSQEVVVGGWRPGAGARAGTFGALLLGIPDGDKLHYVGRVGSGFKDWQL
RDIMEKLEPLAIVESPFADIPREDAAGATWVSPELVAEVTFGEWTGPGRLRHPVWRGWRP
DKSAGEVTLAGS
NT seq 2559 nt NT seq  +upstreamnt  +downstreamnt
gtggcaggcaagcaacaggagcgggtgaacgtggaaggccacgagctcaccctcaccaac
ctgaacaaaatcatctacccggaaaccggcaccaccaaggccgaagtgctggagtattac
gccgcagtggcgcctttcctgatccctgccgctgccaaccggcccgtcacccgcaagcgc
tgggtcaacggagtgggtaccgccgaaaaccccgggcaagtgttcttccaaaagaacctt
gaggactcggcacccaaatggattccccgtgccgccattcagcattcggaccacaccaat
gtttatcccatggtcaacaaccttgcgacgctcacatggatggcccaaatcgcgtcgctg
gaaattcacgtaccgcagtggcaggtggatccttcagggaagccgctccgccccgaccgt
ttcgtcctggacctcgaccccgggcccggggcaggactgtccgagtgcgttgaagtggcc
aagcttgcccgttccatcctgcaggacatgggaatggacccggtccctgttaccagcggc
agcaaaggcatccacctctacactggcctggacgggacgctgaagtccgagcaagtgtcc
gccttcgccaaagagctggcccgggccttggaatcggaccaccccgagctggtggtcagc
gacatgaagaagtccctccgacacggcaaagtgctggttgactggagccagaacagcggc
aacaagaccaccatcgtcccgtattcgctgcgcgggaaggcccaccctacggtcgccgcg
ccccgcacctggcgggagctctcctctccttcgctggaacacctcgactatgtggccgtg
atgaagcgcgtgaagacaggcaaagaccacttcgcgccgatctccgaacgccacctgccg
cctcacggcgaggatgagaatgacgacgacggtactgccggaagcagttcaggcaccggc
cgttcccgcgagcgtgtggtgacagtagagaaccgtctcgccaagtacgtcgggatgcgc
gatccgggcaaaaccccggagccgtttccgtcgtcgtcggctgtttctgcctccccgcaa
tcggcgggctccgcctccgatcagccgaagccgggcgatcctccaccgcccggcggcatt
ttcgtcatccaggagcaccacgcccgccgctaccacttggacctgcgcctggagcaccat
ggcgtcctggcttcctgggcactgccgcgtggcatcccggaaagccccgaccgcaacaac
cttgccgttcataccgaggaccaccccatggaatacgcgaacttcgcgggcgtcattccc
aagggtgagtacggggccgggaccatgaccatttgggaccgcggcgagtacacctgcgag
aagtggcgcgacggcaaggaagtgatcgcgacgctcacaggcgagccgggtggtggcctt
ggtggcaccaaacggttcgcgctcatcaatacgggtcagaactggctgatccatctcatg
aaggagcagccaggagggcgtcggggcgcccaatctgcggccaaagccgcggcacccaag
tccgctccgactcaggcccctgctccccggcccatgccgaactacacccccatgctggcc
acttccgggaccaccgccgatctccgcggcgacgattggctgtatgaactgaagtgggac
ggaatccgcgcaatcatcaccggcaccgagggcaggatccgactcatgagccgcaacgga
aacgatctcaccgccgcctatcccgaactgacggaccgcgcatgctggcccgacggcgat
ttcgtggctgatggcgaaattgtggcgctcggcaaaggatcgcggcctgatttcggccgg
ctgcagctgaggatgaacttggtcaaagctgcggacatcgaacgtgcccgggcaacggtt
ccggtgcagctcatgctgttcgatcttctgtacgacgacggcacggaccttagcgggctg
cctttccacgagcgcagggagaggctttccggatttgcggatcgcttgcggggcggctgt
ccccttcacctttccgcggtgctggaccacgacgttgaggaccttatgacgagtgccgcc
gagcttggcttggaaggagtcatggctaagaaagccgacagccgttacgtgattggccgc
cgcagcaggtcctggatcaagctcaaactggagcagagccaggaagtggtggtgggcggt
tggcggcccggtgccggtgcacgggccgggaccttcggcgcattgctgctgggcatcccg
gacggcgacaagctacattacgtgggccgggtgggcagcggtttcaaggactggcagctc
agggacatcatggagaaactggagcccttggctattgttgagtcgccgttcgcggacatt
ccccgggaagacgctgcgggcgctacatgggtgagtcctgagctcgtggcggaagtgaca
tttggggaatggacgggccctggaaggctgaggcatccggtgtggcgtgggtggcgtccg
gacaagtccgctggcgaggtaacgctggccggctcatga

DBGET integrated database retrieval system