KEGG   Arthrobacter sp. Rue61a: ARUE_c06020Help
Entry
ARUE_c06020       CDS       T02215                                 

Gene name
nedA1
Definition
(GenBank) sialidase NedA
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
arr00511  Other glycan degradation
arr00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:arr00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    ARUE_c06020 (nedA1)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    ARUE_c06020 (nedA1)
Enzymes [BR:arr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     ARUE_c06020 (nedA1)
Bacterial toxins [BR:arr02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   ARUE_c06020 (nedA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 NPCBM_assoc BNR CARDB DUF11 BNR_3 Sortilin-Vps10 N_BRCA1_IG
Motif
Other DBs
NCBI-ProteinID: AFR27537
UniProt: J7LQ58
LinkDB All DBs
Position
622038..625049
Genome map
AA seq 1003 aa AA seqDB search
MARNTSSLHVVSHPPARSSFERTSDLRSSSSPLARIAAVGTVSLGLLAGLGLPATAAPIP
PSNPAAAPGTFTEANIGADRTAANFFYRIPALTYLGNNVVLAAWDGRPGSAADAPNPNSI
VQRRSTDGGQTWGPVTVIAAGHVGDASGPKYGYSDPSYIYDAEAGKVLAFFVYSKDQGFG
GSQFGNNDADRTVISSAVIESSDGGVTWSQPRLITNVTKPGTSKTSPVAGDVRSNFASSG
EGIQLKYGQYKGRLIQQFAGDIRQADGTNKIQAYSVYSDDHGATWHKGDNVGDRMDENKT
VELSDGRVLLNSRDNANQGYRKVAISTDGGATYGPVTQDTELPDPANNGAIARMFPNAAQ
GSADAKKLIFTNASSKTGRENVSARVSCDDGATWPGVRTIRSGFSAYSTVTRLENDKFGV
LYEGNYTDNMPFAKFDDAWLNYVCAPLAVPAVTTAPGATQQVPVTVTNQEAATLSGASAT
VYTPSGWSATTVPVPDVAPGASVTVNVALTAPANASGPQNLNAAFTTANGRVSQFTFTAT
VPAAPQVGLTITGTAPARDVVASPYQMGDVLSYSLNVKSTANVTANSVPVSGTFDSGFLP
PSAPNCRFNNLAAGASYTCTTAKHVITAADIQRGYFVPEASFSITASSTPSLTKTVPFTG
AAVALRDGLLTADISGARADVGRDLATQPYAAGDQVPYAFTVKNTSPLVEKVVPTAGNFS
PFLPEGPGNCRYSVLPAGQSYQCATPRHTVTAEEAEQGFFIPKTTWEASSAGQSTKTITV
DGGEVDLKVREPKLEGTVSAEWSDADGDRFASVGDPVTYTYTVGNAGNVAVTGLEAPDAG
ISAATLPAGDTVTATRERVLTAADVAAGSLGAVSFEATAWNGSRAVAAAAGSDPLALAVQ
PARPDSVPTLTVQELGTPPTDLGTADKYRTGQKVVLKGLEYGNWYYVYLNKTGYRLGWIF
PTTDNAVEFILPSDVKNGRDDAVVLDKDGGQVSFDRLQVTPKG
NT seq 3012 nt NT seq  +upstreamnt  +downstreamnt
gtggcacgtaacacaagtagtctgcacgtcgtttcgcatcctcccgctcgaagcagtttc
gaaaggacatcggatttgagatcctcttcatcacctctcgcccgcatcgccgccgtcggc
accgtcagcctgggccttctggccggcttgggccttcccgccaccgctgcacccattccg
cccagcaaccccgcggcagctcccggtacattcaccgaggccaacatcggcgctgaccgt
acggccgccaacttcttctaccggattccggccctgacctatctgggcaacaacgtggtg
ctcgcggcctgggacgggcgtccgggctcggccgcggatgcccccaacccgaactcgatc
gtgcagcgccgcagcaccgacggcggccagacgtggggacccgttaccgtcatcgccgcg
ggacatgttggcgatgccagcggacccaaatacggatacagcgacccctcctacatttac
gatgccgaagccggcaaggtcttagccttcttcgtgtactccaaggaccagggcttcggc
ggcagccaattcggcaacaatgacgccgacaggactgtgatctcctcggcagttatcgag
tcctcggacggcggcgtcacgtggagccagccccgactcatcaccaacgtcaccaagccg
ggcaccagcaagaccagccctgttgccggcgatgtcaggtccaacttcgcatcctccggc
gaaggcatccagctcaagtacggccaatacaagggccgcctgattcagcagttcgccggc
gatatccgccaggcggacggcaccaacaagatccaggcatactccgtttactccgatgac
catggcgccacctggcacaagggcgacaacgtcggggaccgcatggatgagaacaaaacc
gtggaactttccgacggccgcgtgctcctgaactcacgggacaacgccaaccagggctac
cgcaaggtggccatttccacggacggcggcgccacgtatggcccggtcacgcaggacacc
gaactcccggatcccgccaacaacggcgccattgcgcggatgttccccaacgctgcgcag
ggctcggctgatgccaagaagctcatcttcaccaacgcgagctccaagaccggccgcgaa
aacgtctcggccagggtctcctgtgacgacggcgccacctggccgggcgtccgcaccatc
cgttcgggtttctccgcctactccacggtcacccgcctggaaaacgataagttcggtgtg
ctctacgagggcaactacacggacaacatgccgttcgcgaagttcgacgacgcctggctg
aactacgtctgtgccccgctggctgtcccggctgtcaccaccgcgccgggggccacccag
caggtgcccgtgactgtcaccaaccaggaagccgccacactttcgggcgccagcgccacc
gtctacacacccagcggctggtcggccaccacggtgccggttcccgacgtcgcccccggc
gcttcggtgaccgtcaacgttgccctaacggcaccggccaacgccagcggtccgcagaac
ctcaatgcagccttcacgacggcgaacggccgggtttcgcagttcaccttcaccgcaacg
gtgccggcagctccgcaggtaggcctcaccattaccgggacggcacccgcccgcgatgtc
gtggccagcccctaccagatgggcgacgttctcagctactcgctcaacgtcaagagcacc
gccaacgtcacggccaattcagtaccggtttccgggacgttcgactccgggttcctgccg
ccgtcggcccccaactgccggttcaacaatctggccgcaggtgccagctacacctgcacc
accgccaagcacgtgatcacggcagccgacatccaacgcggctatttcgtgccggaggcc
agcttcagcatcacggcaagctcgacgccgtcgctgaccaaaacggtaccgttcaccggc
gctgcggtggccttgcgtgacggcctgctgacggccgatatcagcggggcgcgcgccgac
gttggacgtgatctggcaacccagccatacgcggccggcgaccaggtcccatatgccttc
acggtgaagaacacgagtccgctggtggagaaggtggtccccacagccggtaacttcagc
ccgttcctgccggaagggcccggcaactgccgctacagcgtgctaccggccggccaaagc
taccagtgtgccaccccgcgccacaccgtgaccgctgaagaagccgagcagggtttcttc
attccgaagaccacctgggaggccagctcggccggtcaaagcaccaagaccattacggtg
gacggcggcgaagtggacctcaaggttcgcgagcccaagctggagggaaccgtgtctgcc
gagtggagcgacgctgacggcgaccgcttcgcgagcgtcggcgatcccgtgacgtacacg
tacacggtgggcaacgccgggaacgtcgcagtgaccggattggaggcgcccgacgccggc
atctcggcggccacgctgcctgccggtgacaccgttacggctacacgagagcgtgtgctg
acagccgcggacgttgctgcggggagtttgggtgctgtctcgtttgaagcgacggcctgg
aatggttcccgggcagttgcggccgcagccgggagtgacccgctggcgctcgccgttcag
ccagcgcgtccagactctgtgccgacactgactgtccaggagttgggcacgccgccgacg
gacctcgggactgcggataagtaccgcacgggccagaaggtagtgctcaagggcttggag
tacgggaattggtactacgtgtacttgaataagacgggctaccggctcggatggattttc
cccaccacggataacgccgtggagttcattcttccgtcggacgtgaagaacggccgggat
gacgcggtggtcctggacaaggacggcggccaagtctccttcgaccgcctgcaggtgacc
cccaagggctag

DBGET integrated database retrieval system