KEGG   Arthrobacter sp. Rue61a: ARUE_c07170Help
Entry
ARUE_c07170       CDS       T02215                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase Ppc
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
arr00620  Pyruvate metabolism
arr00680  Methane metabolism
arr01100  Metabolic pathways
arr01120  Microbial metabolism in diverse environments
arr01200  Carbon metabolism
Module
arr_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:arr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ARUE_c07170 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    ARUE_c07170 (ppc)
Enzymes [BR:arr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     ARUE_c07170 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase Se-cys_synth_N PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AFR27650
UniProt: J7LJZ2
LinkDB All DBs
Position
752281..755079
Genome map
AA seq 932 aa AA seqDB search
MVHTAHQDTDLAAELRADVRRVSTLLGESLVRQHGPELLQLVEQVRLLTKESKEAARGGA
DATGPWSAHDVVAQVRELLASLPLDQATDLVRAFAFYFHLSNAAEQVHRVRGLRTRQEKD
GWLAKAVSEIAGQAGPQVLQDVINGLDVRPIFTAHPTEASRRSVLDKVRKLSDVLAEPTA
DGTSARRRQDRQLAEIIDQMWQTDELRQVRPTPVDEARNAIYYLNSILTDAMPEMLTDLS
ELLAEHGVTLPAAAAPLKFGSWIGGDRDGNPNVTAAVTKEILQLQNQNAVRISIALIDEL
ISVLSNSTALFGADQELLDSITADLKNLPGLDKRILELNAQEPYRLKLTCIKAKLINTGR
RISASTYHEPGRDYATTPELLAEFGLLEASLRNHSAGLVADGALARVRRAIAAFGLHLAT
LDIREHADYHHDAVGQLVDRLGTEKPYGELTREERFTFLGAELASRRPLSGHPIKLEGTA
DGTYDVFRSIRQALHTYGPDVVETYIISMTRGADDVLAAAVLAREAGLIDLFSGKPHAKI
GFAPLLETVEELRASAEIVDQLLSDPSYRELVRLRGDIQEVMLGYSDSNKESGVMTSQWE
IHKTQRKLRDVAAKHGVRVRLFHGRGGSVGRGGGPTYDAIMAQPNGVLEGEIKFTEQGEV
ISDKYSLPELARENLELSLAAVMQGSALHRTPRTSDDERERYANVMETISDAAFARYRTL
IDDPQLPAYFLASTPVEQLGSLNIGSRPSKRPDSGAGLGGLRAIPWVFGWTQSRQIVPGW
FGVGSGLKAAREAGDTDQLLEMMDRWHFFRSVISNVEMTLAKTDMEIAGHYVSSLVPEEL
HRLFHMIRDEYELTVAEIERLTGEMELLDAQPTLKRSLEIRDQYLDPISYLQVELLRRVR
EEQLSGGEIDERLQRAMLITVNGVAAGLRNTG
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atggttcacactgcccatcaagacaccgatctcgctgccgaactgcgtgccgacgtacgc
cgggtttccacacttctcggcgagtccctggtacgacaacacggtccggaattgctccaa
ctcgtggagcaagttcgcttgctgaccaaggagtccaaggaagccgcacggggcggcgcg
gatgccaccggcccatggagcgcgcacgacgtcgttgcccaggttcgcgagttgctcgcc
tccctgccgctggaccaggcgactgacctggttcgtgcctttgcgttttacttccacctc
agcaacgcggcggagcaagtacatcgcgtccgtggactgcgcacccgccaggaaaaagac
ggttggctggcgaaggcggtctcagagatagccggccaggcgggaccccaggttctgcag
gatgtgatcaacggactcgacgtccgccccattttcacggcgcaccccaccgaggcttca
cgtcgttctgtgttggacaaggtccgcaaactttcggacgtccttgctgagcccacagct
gacgggacctccgcgcggcgccgtcaggaccggcaactcgctgaaatcatcgaccaaatg
tggcagaccgacgagctccgccaagtacgccccactcctgtggatgaggcccggaatgcc
atctactacctgaacagcattctgacggacgccatgccggaaatgctgacggacctttcg
gaacttctggccgagcatggtgtcacactccctgccgccgccgcaccgctgaagtttggt
tcgtggatcggtggcgaccgcgacggcaacccgaacgttactgctgctgtcaccaaggaa
atcctgcagttgcagaaccagaatgctgtccgcatcagcattgccctcatcgacgaactc
atctcggtactttccaactcaacggctctttttggggccgaccaagagctgctggattcg
atcaccgcggacctcaagaacctccccggactggacaaacgcatccttgaactgaacgcg
caggagccctacaggctcaagctgacctgcatcaaggccaagctcattaacaccggtcgc
cgcatttcagcttcgacttatcacgagccgggccgcgactacgcaaccactcctgagttg
ctggcggagtttggactgcttgaagcctcgttgcggaaccattccgctggactggtggca
gacggcgccctggcccgcgtccgccgggcaatcgctgcctttggtctgcacctggcaacc
ttggacatccgtgaacacgccgattaccaccacgatgccgtagggcaactcgtggacagg
ctcggcaccgaaaagccttacggcgaattgacgcgtgaggaacgcttcaccttcctgggg
gccgagctggcttcccgccgcccgctctccggccacccgatcaagcttgaaggcactgcg
gacggcacatatgacgtcttccggagtatccgccaggccctgcacacctatggcccggac
gtcgtggaaacctacatcatttccatgacccgcggcgccgatgatgtcctggccgcagca
gtccttgcccgcgaggccggtctgatcgacctcttcagcggcaagccccatgccaagatc
gggttcgctccgctattggaaacggtggaggaactccgggcctcggctgagattgtggac
cagttgctgtccgatccgtcctaccgggaacttgtccgcctccgcggagacatccaggag
gtcatgctgggttactccgattccaataaggaatccggcgtgatgaccagccagtgggag
atccacaagacccagcgcaagttgcgcgatgtggcggccaagcacggcgtccgcgttcgt
ctcttccacggccgcggtggatccgttggccgcggtggcggacccacctacgatgccatc
atggctcaaccgaacggcgttctggaaggcgagatcaagttcacggagcagggtgaggtc
atctcggacaagtactccctccccgagctggcccgcgaaaacctggagctctccctggcc
gccgtgatgcagggttcggcgctgcaccgcactccgcgtacatcggatgatgaacgtgag
cgctacgccaatgtcatggaaaccatctcggatgcagcgttcgcccgctaccgcacgctg
attgacgatccccagcttccggcgtacttcctggcgtccacacctgtggagcagctgggt
tcattgaatatcggttcgcggccctccaagcgtccggattccggtgcgggacttggtggc
ctgcgggccattccgtgggttttcggctggactcagtcacgccagatcgttcccggctgg
ttcggagtgggctccggtttgaaggctgcgcgggaagccggcgacacggatcagttgctg
gagatgatggaccgctggcacttcttccggtcagtcatctccaacgtggaaatgaccttg
gccaagacggacatggaaattgccggtcattacgtttcgtccctggtccccgaggaactg
caccgcttgttccacatgattcgtgacgagtacgagctcaccgttgccgagatcgaacgg
ctgacgggtgagatggagttgctggacgcccagcctacgctgaagcgttcactcgaaatc
cgcgaccaatacctggatccgatcagctatctgcaagtggagctccttcgccgcgtgcgc
gaggagcagctgtccgggggcgagatcgacgagcgcctccagcgggccatgctcatcacc
gtcaacggcgtagccgccggcctgcgcaataccggctag

DBGET integrated database retrieval system