KEGG   Arthrobacter sp. Rue61a: ARUE_c31240Help
Entry
ARUE_c31240       CDS       T02215                                 

Gene name
pfp
Definition
(GenBank) pyrophosphate--fructose 6-phosphate 1-phosphotransferase Pfp
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
arr00010  Glycolysis / Gluconeogenesis
arr00030  Pentose phosphate pathway
arr00051  Fructose and mannose metabolism
arr00052  Galactose metabolism
arr00680  Methane metabolism
arr01100  Metabolic pathways
arr01110  Biosynthesis of secondary metabolites
arr01120  Microbial metabolism in diverse environments
arr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:arr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ARUE_c31240 (pfp)
   00030 Pentose phosphate pathway
    ARUE_c31240 (pfp)
   00051 Fructose and mannose metabolism
    ARUE_c31240 (pfp)
   00052 Galactose metabolism
    ARUE_c31240 (pfp)
  09102 Energy metabolism
   00680 Methane metabolism
    ARUE_c31240 (pfp)
Enzymes [BR:arr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ARUE_c31240 (pfp)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     ARUE_c31240 (pfp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AFR30008
UniProt: J7LU70
LinkDB All DBs
Position
3435122..3436147
Genome map
AA seq 341 aa AA seqDB search
MKIGILTSGGDCPGLNAVIRGSVLKGIAIHGQEFVGFRDGWRGVVEGDVIDIPRTMVRGI
AKQGGTILGTSRTNPFENGGGPDVIKAHMERLGIDAIIAIGGEGTLAAAKRLTDAGLKIV
GVPKTVDNDLDATDYTFGFDTAVQIATEAIDRLRTTGESHHRCMIAEVMGRHVGWIALHA
GMAAGAHAILIPEQKASIEQITEWVQEAHDRGRAPLVVVAEGFVPDHMESPHSERGLDTF
GRPRLGGIADQLAPEIEARTGIETRATILGHIQRGGVPTAYDRVLATRLGMAAIDSVVEG
RWGTMVALKGTDISHVGFEEALGKLKTVPQHRYDEASVLFG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattggcattcttaccagcggtggcgactgccccggcctcaacgcagtgatccgg
ggatcagtcctcaagggtattgccatccacggccaggagtttgtgggcttccgcgacggc
tggcgtggtgtggttgaaggtgatgtcatcgacatcccccgcaccatggtccgcggtatt
gccaagcagggtggcaccattctgggcacctcccgcaccaaccccttcgaaaacggcggt
ggcccggacgtcatcaaggcgcacatggaacgcctgggcattgacgccatcattgcaatt
ggaggcgagggaacgctggcagcagccaagcgcctcaccgacgcgggcctgaagattgtt
ggtgtccccaagaccgtggacaacgacctcgacgccaccgactacaccttcggtttcgat
accgccgtgcagatcgcaactgaggccatcgaccggctccgcaccaccggcgaatcccat
caccgctgcatgatcgccgaagtcatgggccgccacgtcggctggatcgccttgcacgcc
ggcatggcagcgggcgcccacgccatcctcatcccggaacagaaggcaagcatcgagcag
atcaccgaatgggtccaggaagcccacgaccgtggccgtgcgccgcttgtggtggttgct
gaaggctttgttccggaccacatggagtccccgcactccgagcgcggcctggataccttc
ggccgtccccgccttggcggcatcgccgatcagctggcacccgagattgaggcgcgcacg
ggcatcgaaacacgggccacgatcctcggccatatccaacgtggtggcgtccccaccgcc
tacgatcgcgttttggcgacgcgcctgggcatggctgccatcgattccgtagtggaaggc
cgctggggcaccatggtggcactgaagggtacggacatctcccacgtgggcttcgaggaa
gcgctcggcaagctcaagacagtgccgcaacaccgctacgacgaagcgtctgtgctcttc
ggctag

DBGET integrated database retrieval system