KEGG   Arthrobacter sp. Rue61a: ARUE_c32180Help
Entry
ARUE_c32180       CDS       T02215                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate aminotransferase GabT
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
arr00250  Alanine, aspartate and glutamate metabolism
arr00280  Valine, leucine and isoleucine degradation
arr00410  beta-Alanine metabolism
arr00640  Propanoate metabolism
arr00650  Butanoate metabolism
arr01100  Metabolic pathways
arr01120  Microbial metabolism in diverse environments
Module
arr_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:arr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    ARUE_c32180 (gabT)
   00650 Butanoate metabolism
    ARUE_c32180 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ARUE_c32180 (gabT)
   00280 Valine, leucine and isoleucine degradation
    ARUE_c32180 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ARUE_c32180 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:arr01007]
    ARUE_c32180 (gabT)
Enzymes [BR:arr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     ARUE_c32180 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     ARUE_c32180 (gabT)
Amino acid related enzymes [BR:arr01007]
 Aminotransferase (transaminase)
  Class III
   ARUE_c32180 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AFR30099
UniProt: J7LYZ2
LinkDB All DBs
Position
complement(3530349..3531719)
Genome map
AA seq 456 aa AA seqDB search
MTTTANELSYRIEQKRNINGAFPGPKSQALAERRSAVVAAGVASGVPVYVEDADGGIIRD
VDGNSFIDLGSGIAVTSVGASDPAVVAAVQEAAAHFTHTCFMVTPYEGYVAVAEQLNRLT
PGDHAKRTVLFNSGAEAVENAVKVARLATGRDAVVAFDHAYHGRTNLTMALTAKAMPYKT
NFGPFAPEVYRMPMSYPFREENPEITGAEAAKRAITMIEKQIGGDQVAAIIIEPIQGEGG
FIVPAEGFLPALSEWAKEKGIVFIADEVQSGFCRTGEWFAVDHEGVVPDIITMAKGIAGG
LPLSAITGRADLLDAVHPGGLGGTYGGNPVACAAALAAIDTMEQHDLNGRARHIEELALG
KLRELAAELSAGGGSVVGDIRGRGAMLAIELVQPGSKEPNAELTKAVAAACLQEGVIILT
CGTYGNVIRLLPPLVISDELLIDGLEVLAAAIKAHA
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccaccgcgaacgaactctcgtaccgcatcgagcagaagcgcaacatcaacggc
gccttccccggccccaagtcgcaggcactggctgagcgccgctccgccgtcgttgctgcc
ggcgtcgcctcgggcgtccccgtctacgttgaagacgccgacggcggcatcatccgcgac
gtggacggcaactccttcatcgacctcggctccggcattgccgtgaccagcgtcggcgcg
tccgaccccgctgtcgtcgccgctgtccaggaagctgctgcgcacttcacgcacacctgc
ttcatggtcaccccgtacgagggctatgttgcagttgccgagcagctcaaccgcctcacc
ccgggcgatcacgccaagcgcaccgtgctgttcaactccggcgctgaagccgtggagaac
gctgtcaaggttgcacgcctggctaccggccgcgacgccgtcgtagctttcgaccacgcc
taccacggccgcaccaacctgaccatggcgctgactgccaaggccatgccgtacaagacc
aacttcggcccgttcgcgcccgaggtttaccgcatgcccatgagctacccgttccgtgaa
gagaacccggaaatcaccggtgccgaggccgccaagcgtgccatcaccatgatcgagaag
cagatcggtggcgaccaggttgccgcgatcatcatcgaacccatccagggtgagggcggc
ttcatcgttccggccgaaggcttcctcccggcactgtccgagtgggccaaggagaagggc
atcgtcttcatcgctgatgaggtccagtccggcttctgccgcacgggcgaatggttcgcc
gttgaccacgaaggtgttgtcccggacatcatcaccatggccaagggcatcgccggcggc
ctgccgctgtccgcaatcaccggccgcgccgacctgctcgacgccgtccacccgggcggc
cttggcggcacctacggtggcaacccggttgcttgcgcagcagcactcgcagcgatcgac
accatggagcagcacgaccttaacggccgcgcccgccacatcgaagagctcgccctgggc
aagctccgcgaattggcagccgagctttccgcaggcgggggttccgtggttggcgacatc
cgcggccgcggcgcaatgctggccatcgagctcgttcagcccggttccaaggaaccgaac
gctgagctcaccaaggcagttgccgccgcttgcctccaggaaggcgtcatcatcctgacc
tgtggcacctacggcaacgtgatccgcctgctcccgccgctggtcatcagcgacgaactg
ctcatcgatggcctcgaggtcctcgccgcagccatcaaggcccacgcgtaa

DBGET integrated database retrieval system