KEGG   Arthrobacter sp. Rue61a: ARUE_c40090Help
Entry
ARUE_c40090       CDS       T02215                                 

Gene name
lig
Definition
(GenBank) DNA ligase Lig
Organism
arr  Arthrobacter sp. Rue61a
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: AFR30881
UniProt: J7LZT1
LinkDB All DBs
Position
complement(4401510..4402574)
Genome map
AA seq 354 aa AA seqDB search
MDLPVMPPVSPMLAKSVPTIPDVGHYEPKWDGFRTIVFKDGDEIVLGSRNEKPMTRYFPE
VVEALRKNLPDKCVIDGEIVLIEGKRLEFEVLQQRIHPADSRVRMLAEKTPASMIAFDIL
ALGDENLMDKPFSERRAILERTLAKADPPVYVTPAVTDLERAQEWFVQLEGAGLDGVLSK
PLDGAYQPNKRVMFKTKHERTADCVVAGFRWHKTAKVVGSMLLGLHDDTGRLHHVGVVAS
FPMARREALVAELEPYQVELSEHPWGEWANQDETAGGSRMPGAQSRWSGGKDFSFVPLRP
ELVIEVKYDYMEGDRFRHTTQFRRWRPDRTPESCTYSQLEEPADYDLGEILRLP
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcctgtgatgccacccgtctcgcccatgctcgccaaatccgttccgacaatc
cccgatgttgggcactacgagcccaaatgggacgggttccggaccatcgtcttcaaggat
ggcgacgagatcgtcctgggcagccgcaacgagaagccgatgacccgctacttccccgag
gtggtggaggcgctcaggaagaacctgccggacaaatgcgtgatcgacggcgagatcgtc
ctgatcgagggcaagaggctcgaattcgaggtactccagcaaaggatccaccccgccgac
agccgcgtccggatgctcgccgagaagaccccggcgtccatgattgcgttcgacatcctc
gcgctgggcgacgagaacctcatggacaagccgttctccgagcgccgcgccatcttggag
cgtacgctcgccaaggccgatccgcctgtctatgtgacccccgcagtgacggatctcgag
cgggcgcaggaatggttcgtgcagttggaaggcgcgggactggatggggtgctgtccaag
ccgttggacggggcctaccaacccaacaagcgcgtgatgttcaaaaccaaacacgagcgc
acggcagactgtgtggtggcgggattccgttggcacaagaccgcgaaagttgtggggtcg
atgttgctcggcctgcacgatgacactggccggctgcatcatgtgggagtggtggcatcg
ttccctatggcccgcagggaagctttggtggcagaactggagccgtaccaggttgaactc
agcgagcacccatggggtgagtgggccaaccaggatgaaactgccgggggttcacgcatg
cccggcgcccaaagccggtggagcgggggtaaggacttctccttcgtgccgctgcgcccc
gagctggtgatcgaagtaaagtacgactacatggaaggcgacaggttccggcacaccacg
cagttccgtaggtggcggccggacaggacccccgagagctgcacgtactcgcaactggaa
gagcctgccgactacgatctcggggaaatcctgaggctgccctag

DBGET integrated database retrieval system