KEGG   Arthrobacter sp. Rue61a: ARUE_c41120Help
Entry
ARUE_c41120       CDS       T02215                                 

Gene name
gadB
Definition
(GenBank) glutamate decarboxylase GadB
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
arr00250  Alanine, aspartate and glutamate metabolism
arr00410  beta-Alanine metabolism
arr00430  Taurine and hypotaurine metabolism
arr00650  Butanoate metabolism
arr01100  Metabolic pathways
arr01110  Biosynthesis of secondary metabolites
arr01120  Microbial metabolism in diverse environments
arr02024  Quorum sensing
Module
arr_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:arr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ARUE_c41120 (gadB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ARUE_c41120 (gadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ARUE_c41120 (gadB)
   00430 Taurine and hypotaurine metabolism
    ARUE_c41120 (gadB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ARUE_c41120 (gadB)
Enzymes [BR:arr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     ARUE_c41120 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AFR30984
UniProt: J7M0E9
LinkDB All DBs
Position
4501735..4503135
Genome map
AA seq 466 aa AA seqDB search
MSRSHRASQHEPDTAVELNPLFSRPGESTIFPRFTLPDGESLPATAYQVVHDEAMLDGNS
RLNLATFVGTWMETEASKLYAETFDKNMIDKDEYPQTALIETRCWRMLADLWNAPDPEKS
IGTSTIGSSEACMLGGLALKRRWQHARRAAGKSTEKPNLILSSAVQVCWEKFCNYWDVEP
RFVPVSAEHPTLDGHDLDQYVDENTIGVVAILGVTYTGKYEPVELISDALDEIQARHGLD
IPIHVDGASGAMVAPFLQPETVWDFRLPRVASINTSGHKYGLVYPGLGWVVWRDAAALPE
DLIFHVSYLGGDMPTFALNFSRPGAQVLLQYYLFLRLGFAGYRSVQATSRDVALYLSSEI
GAMDAFTLWSDGSDIPVFAWQLSDGHTEHWNLHHLSERLRMNGWLVPAYPLPDGLGDVTV
QRIVVRNGFTRDLASSFLADLKKEVDYLDSLTAPMPTDKQAEGFHH
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgagcagatcccaccgagcgtcacagcatgaaccggacaccgccgtcgaactcaatccc
ctgttcagcaggcccggagaatccaccatctttccccgtttcaccctgccggacggtgaa
tccttaccggccacggcctaccaggttgtgcacgatgaagcgatgctggacggcaactcg
cggctgaacctggccactttcgttggaacgtggatggagacggaagcctccaagctctac
gccgagacgttcgacaagaacatgatcgacaaggacgagtacccccaaacggctctgatc
gaaacccgttgctggcggatgctcgcggatctgtggaacgctccggatcccgagaagagc
atcggcacctccaccatcggatcgtcggaggcctgcatgctgggtggcttagccttgaag
cgacggtggcaacacgcaaggcgcgcagcgggcaagtccacggagaaacccaatctcatc
ctcagctccgccgttcaagtgtgctgggagaagttctgcaattactgggatgtggagccc
cgttttgtcccggtctcagccgagcaccccacgctggatggccatgacctggaccagtac
gtggacgaaaacaccatcggcgtggtcgccatcctgggtgtcacctacaccgggaagtat
gagcctgtggaactcatctcggacgcgttggacgagatccaggcccgccatggactggac
attcccatccacgtggacggggcttccggagccatggtggcaccgttcctgcaacctgaa
acggtgtgggatttccggctcccccgcgtcgcatcgatcaacacctccggccacaaatat
gggctggtgtatcccggactgggctgggtggtgtggcgggacgcggcggcgctccccgag
gacctgatcttccacgtcagctacctcggcggggacatgcccacgtttgcgctgaacttt
tcacggcccggcgcccaagtgctgctgcagtattacctcttcctgcgccttggctttgcc
gggtacaggtccgtccaagcgacgtcacgggatgtggccctttacctctccagcgaaatc
ggtgccatggacgcgttcaccctgtggagcgacggctcggacattccggtattcgcgtgg
cagctcagcgacggccacacggaacactggaacctgcaccatctctcggaacggctcaga
atgaacggctggctggttccggcgtaccccctccctgacggtttgggtgacgtcacggtc
cagaggatcgtggtccgcaacggtttcacccgcgacctcgcctccagtttcctggctgac
ctcaagaaggaagtggactacctcgacagtctcacggcaccgatgcccaccgacaagcag
gcagagggctttcaccactaa

DBGET integrated database retrieval system