KEGG   Arthrobacter sp. Rue61a: ARUE_c42250Help
Entry
ARUE_c42250       CDS       T02215                                 

Gene name
bgaB3
Definition
(GenBank) beta-galactosidase 1
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
arr00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:arr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    ARUE_c42250 (bgaB3)
Enzymes [BR:arr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     ARUE_c42250 (bgaB3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_35 Glyco_hydro_42C Cellulase Glyco_hydro_2_C Glyco_hydro_14 DUF4350
Motif
Other DBs
NCBI-ProteinID: AFR31097
UniProt: J7LZ67
LinkDB All DBs
Position
4620470..4622512
Genome map
AA seq 680 aa AA seqDB search
MTDVLQAPATQRAPAPWVQRPAGLCYGGDYNPEQWPREVWVEDIALMKDAGINLVSIGIF
SWVLLEPREGEYHFEWLDDLMDLLADAGISVDLGTPTAAPPAWFWKKYPQSRPVTREGVT
LGNGSRGMASPSSPEYRRAATNITEQLARRYASHPALVLWHVHNEFGAPVSESYDAQSVL
AFRDWLRHRYGTLDALNQAWGTLFWGQKYGEWDEIDAPRLSASVSNQAQRLDFRRFTSDA
MLQCFIAERDVIKKYTPHLPVTTNFMATNCLSADYWAWAKEVDIVANDHYLVAQRTDNHV
LLSMDADLTRSLAGNRPWMLMEHSTGAVNWQGRNIAKRPGELARNSLSHLARGADAIMFF
QFRASRYGAEKFHSAMLPHAGTGTRIWREVMDLGEDLGKLSPVKGSVVKSRVAILWDVES
FWAQDLEWRPSSDLDHRERIESFYSVLWNRGISVDFAHPEADLSGYDLVLAPALYLVGDK
AAANISRYVHDGGHLMVSYFSGIVDANDTVPAGASPGGLRDVLGLEIHEFLPLRENETVT
MGNGATGTVWSEEIHPGTANVLSRYVDGPAAAGPAITRNEFGDGTAWYISTKLDGGHLAD
VVLDAVRAAGIELGVQPPTGLEVASRDSEDGTFTFLINHMDADAEYPASGRNLISGEDVS
GTAHIPAGTICVVHTPAEQR
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgacagacgtcctgcaggcccccgccacccaacgcgcacccgcgccttgggtacagcga
ccggccggcctttgctacggcggggattacaaccccgagcaatggccccgcgaggtctgg
gtggaagacatcgcgctgatgaaagacgccgggatcaacctggtcagcatcggcatcttc
tcctgggtgttgctcgaaccacgcgaaggtgaataccacttcgaatggcttgatgacttg
atggacctgctggccgatgccggcatcagcgtggacctcggaacacctacggcggcaccg
cccgcatggttctggaagaagtacccccagtcgcgtcccgtgacccgcgagggcgtcacc
ttgggcaacggatcgcgtggcatggccagccccagctcgccggaataccgccgggcggcc
accaacatcaccgaacagctcgcacgccgctacgcttcccaccccgcgctggttctttgg
cacgtccacaatgaattcggcgcaccggtcagtgagtcctacgacgcgcagtccgtgctg
gcgttccgcgattggctccgccaccgttatggcaccttggacgccctgaaccaggcctgg
ggcacccttttctgggggcagaagtacggcgaatgggatgagatcgacgcacccaggctt
tcagccagcgtcagcaaccaggcacagcggctcgacttccgccggttcacctcggacgcc
atgctgcagtgcttcattgccgagcgcgatgtcatcaaaaagtacacgccccaccttccg
gtgaccaccaacttcatggccaccaactgcctttcagctgactactgggcctgggccaag
gaagtggacatcgttgcgaacgaccactacctggttgcgcagcgcacggacaaccacgtt
cttctctccatggatgccgacctcacgcgatccctggcgggcaaccggccctggatgctg
atggaacactccaccggggccgtgaactggcagggacggaacatcgccaaacggccgggc
gaattagcccgcaacagcctgtcccacctggcccgcggggcggacgccatcatgttcttc
cagttccgcgcatcccgctatggcgcggaaaagtttcactccgccatgctcccgcacgcc
ggcaccggtacccggatctggcgcgaggtcatggacttgggcgaagacctcgggaaactc
tcccctgtgaagggctccgtcgtgaagtctcgcgtggctatcctctgggacgtggaatca
ttctgggcgcaagatcttgaatggcggcccagcagcgatcttgaccaccgcgaacggatc
gaatccttctactccgtcctgtggaaccgcgggatcagtgtggacttcgcccaccccgaa
gccgacctctccggttacgacctggtcctcgccccggccctctacctggtgggtgacaag
gcagccgcaaacatcagccgctacgtccacgacggcggacatctgatggtgtcctatttc
tccggcatcgtcgatgccaacgacaccgtcccagcaggcgcctcccccggtggcctccgc
gacgtcctcggtttggagatccacgaattcctgcccttgcgtgagaacgaaaccgtcacc
atgggcaacggcgccaccggaaccgtttggtcggaggaaattcaccccggcaccgccaac
gtgctgagccgctatgttgacggccctgcggccgccggcccggccattacgcggaacgaa
ttcggcgacggcaccgcttggtacatttccacaaagctcgacggcggccacctcgccgac
gtcgtactggacgccgtgagggcggcaggaattgagcttggcgtccaaccaccgacgggg
ctggaggttgcttcacgcgattcagaggatggcactttcaccttcctgatcaaccacatg
gatgccgacgctgaatacccggcgagtggacgcaacctgatctccggcgaggacgtcagc
ggaacagcacacattcccgccggcaccatctgcgtggtccacaccccagcggaacagcgc
tga

DBGET integrated database retrieval system