KEGG   Arsenicicoccus sp. oral taxon 190: ADJ73_00720Help
Entry
ADJ73_00720       CDS       T04014                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ars  Arsenicicoccus sp. oral taxon 190
Pathway
ars00564  Glycerophospholipid metabolism
ars01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ars00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    ADJ73_00720
Enzymes [BR:ars01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     ADJ73_00720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 Pyr_redox_2 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AKT50215
UniProt: A0A0K1F6D4
LinkDB All DBs
Position
1:complement(151213..152955)
Genome map
AA seq 580 aa AA seqDB search
MTTTATTALTAQSRAAALEEMASGEPLDLLVVGGGVTGAGIVLDAASRGLRVGIVEAEDW
ASGTSQWSSKLVHGGLRYLYQLNFALVAEALKERGLLLTTLAPHLVKAQPFLWPLKLPVV
ERSYSAVGVGMYDALALAGAKGTKTVPLQKHYTRQGAQELFPDIRDDALTGAIRFYDARV
DDARLVIDLVRTAAGYGALAATRTRVTSFVKDDAGRVVGAEVHDAEGDRDLTIRAHRVVA
AAGVWTEDVEAMTGSDQGLKVLASKGIHIVVPKERIQGETGLFLRTEKSVLFVIPWERYW
VIGTTDTPWEQDLRNPVATAEDIDYVLEQANSVLARPLTRDDIIGTYAGLRPLLQPHRGS
GGSSTKVSREHTVAEVAPGLWSIAGGKLTTYRVMAEDAVDVALGEEAAEANPSVTEHTPL
VGAAGFDAYRHQAPRIAAAYGWSAEQVEHLLSRYGAELPALLALVDADASLGEPLATAPA
YLRVEAAFAVTHEGALHLEDILMHRIRLHYETRDRGVSALEEIGSIAAPLLGWDDDDLAR
EQAAYRARVAGEAAAEQERTDAAASAARAQVTGEALPASS
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgacagcgacgacggcactgaccgcacagagccgggcggcagccctggaggag
atggcgagcggggagcccctggacctgctcgtggtcggcggtggcgtcaccggcgcgggc
atcgtgctggacgccgcgagccggggcctgcgcgtcggcatcgtcgaggccgaggactgg
gcctccggcacctcccagtggtcctccaagctggtccacggcggcctgcgctacctctac
cagctcaacttcgcactcgtggccgaggccctcaaggagcgcggcctgctgctcacgacc
ctcgccccgcacctggtcaaggcccagcccttcctgtggcccctcaagctgccggtcgtc
gagaggtcctacagcgccgtgggggtggggatgtatgacgccctcgcgctcgccggggcc
aagggcaccaagaccgtcccgctgcagaagcactacacgcgccagggcgcccaggagctc
ttccccgacatccgcgacgacgcgctgaccggcgcgatccgcttctacgacgcccgcgtc
gacgacgcccgcctggtcatcgacctggtccgcaccgccgccgggtatggcgcgctcgcg
gccacccgcacgcgagtcacctccttcgtcaaggacgacgcgggacgggtcgtgggggcc
gaggtgcacgacgccgagggcgaccgcgacctgacgatccgcgcgcaccgggtggtcgcc
gccgccggagtctggaccgaggacgtcgaggcgatgacgggctccgaccagggcctgaag
gtgctggcgtccaaggggatccacatcgtcgtgcccaaggagcggatccagggggagacc
gggctgttcctgcgcaccgagaagtccgtgctgttcgtcatcccctgggagcgctactgg
gtcatcggcacgaccgacaccccgtgggagcaggacctgcgcaacccggtggccaccgcc
gaggacatcgactacgtcctcgagcaggccaactcggtgctggcccgtcccctgacccgc
gacgacatcatcggcacgtatgccgggctgcgccccctcctgcagccccaccgcggcagc
ggcgggtcctccaccaaggtgtcccgcgagcacaccgtggccgaggtcgccccggggctg
tggtcgatcgccggcggcaagctgacgacctatcgcgtcatggccgaggacgccgtcgac
gtcgcgctgggcgaggaggcggccgaggccaacccgtccgtcaccgagcacacgccgctg
gtcggcgcggccgggttcgacgcctaccgccaccaggctccgcgcatcgccgccgcctac
gggtggagcgccgagcaggtcgagcacctgctgtcccgctacggcgcagagctcccggcc
ctgctggccctcgtcgacgccgacgcctccctgggggagccgctcgcgaccgcgcccgcc
tacctgcgggtggaggcggcgttcgccgtcacccacgagggcgcgctgcacctcgaggac
atcctcatgcaccgcatccggctgcactacgagacccgcgaccggggcgtcagcgctctc
gaagagatcggctcgatcgccgcaccgctgctcggctgggatgacgacgacctcgcgcgg
gagcaggcggcctaccgcgcccgcgtggcgggcgaggccgcggcggagcaggagcggacc
gacgccgccgcctccgcggcccgcgcccaggtcaccggcgaggcgctgccggcctcgtcc
tga

DBGET integrated database retrieval system