KEGG   Arsenicicoccus sp. oral taxon 190: ADJ73_04230Help
Entry
ADJ73_04230       CDS       T04014                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ars  Arsenicicoccus sp. oral taxon 190
Pathway
ars00680  Methane metabolism
ars01100  Metabolic pathways
ars01110  Biosynthesis of secondary metabolites
ars01120  Microbial metabolism in diverse environments
ars01130  Biosynthesis of antibiotics
ars01200  Carbon metabolism
ars01230  Biosynthesis of amino acids
ars03018  RNA degradation
Module
ars_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ars00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ADJ73_04230
   00030 Pentose phosphate pathway
    ADJ73_04230
   00051 Fructose and mannose metabolism
    ADJ73_04230
   00052 Galactose metabolism
    ADJ73_04230
  09102 Energy metabolism
   00680 Methane metabolism
    ADJ73_04230
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    ADJ73_04230
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ars01009]
    ADJ73_04230
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ars03019]
    ADJ73_04230
Enzymes [BR:ars01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ADJ73_04230
Protein phosphatases and associated proteins [BR:ars01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ADJ73_04230
Messenger RNA biogenesis [BR:ars03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     ADJ73_04230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AKT50712
UniProt: A0A0K1F8I0
LinkDB All DBs
Position
1:complement(884738..886984)
Genome map
AA seq 748 aa AA seqDB search
METVHETAPRMRIAVLTSGGDAQGMNAAVRAVVRTALHLGAEVFVIYEGYQGMVDGGDGI
RLAGWDDVGNVLHRGGTVIGTFRSADFRERAGRMAAAAHLLEHGIDRLVVIGGDGSLSGL
DLFRQEWPGLLADLVEQGRISAATAAAHPTLMIAGLVGSIDNDLVGTDMTIGADSALHRI
VDAIDAIASTAASHQRSFVVEVMGRHCGYLALMSAIAGGCDYVLIPEHPPAPGWEERMCA
ELRRGRAAGRRDSIVIVAEGAQDRDGRPITAAYVRDTIEQRLGEDTRVTILGHVQRGGRP
SAFDRWASTWLGYAAAHEVLSATAETVAPVVGIRGNRVVTVPLVEAVERTREVPAAIASG
DYARAMALRGGSFTEMTQIFTEMSEPPTPQVDGTPRRIGILHAGGLAPGMNTAARAAVRL
GLDRGHTMLGIQGGYPGLRDGDIRELAWGDVEGWTAIGGAELGVRRSLPEVEHLYPIGRA
LEEHRVDALLVIGGWNAYVGAQTLWQERDRYPAFRIPMVCVPASIDNNLPGSELAVGADT
ALNAIVDALDRIKQSASARRRCFVVETMGRYCGYLALMGGLAGGAERVYLHEEGITLDDL
QRDVQRLRSSFDAGRRLFLAVRNERSSEQYTLDFLARLFDQEGQERYDVRQAVLGHVQQG
GDPSPFDRILATRLVAHAIDLLTGELAAGGQEAQLVGLVRGRVRATPLARMPELMDLVHR
RPRDQWWLDLRPVVRAVSEPGAAAPTGL
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atggagaccgtgcacgagaccgccccccgcatgcggatcgcggtgctgaccagtggcggc
gacgcccagggcatgaacgccgccgtccgcgccgtcgtgcgcaccgcgctgcacctgggg
gcggaggtcttcgtgatctacgagggctaccaggggatggtcgacggtggggacggcatc
cgactggccggctgggacgacgtcggcaacgtgctgcaccggggtgggacggtcatcggc
accttccgcagcgcggacttccgcgagcgagcaggccgtatggcggccgccgcccacctc
ctcgagcacggcatcgaccggctggtcgtcatcgggggcgacggctcgctgagcgggctg
gacctcttccgtcaggaatggccggggctgctcgccgacctcgtggagcagggccggatc
agcgccgccacggccgcggcgcacccgacactcatgatcgccggcctcgtcggctcgatc
gacaacgacctcgtcggcaccgacatgacgatcggcgcggacagcgcgctgcaccggatc
gtcgacgccatcgacgcgatcgcgagcaccgcggccagccaccagcgcagcttcgtcgtg
gaggtgatggggcggcactgcggctacctggccctgatgagcgccatcgccggcggctgc
gactacgtgctcatcccggagcacccgcccgccccgggctgggaggagcggatgtgcgcc
gagctgcggcgcggtcgcgcggccgggcgacgcgactccatcgtcatcgtcgccgagggg
gcccaggaccgggacggccgaccgatcacggcggcctacgtgcgggacaccatcgagcag
cggctcggggaggacacccgggtgacgatcctcggccacgtgcagcggggcgggcggccc
agcgcgttcgaccgctgggcgtcgacctggctcggttacgccgccgcgcacgaggtcctg
tccgcgacggccgagacggtggccccggtggtcggcatacggggcaaccgcgtggtcacc
gtcccgctcgtcgaggcggtcgagcgcaccagggaggtgccggccgccatcgcgagcggc
gactacgcgcgggcgatggcgctgcggggcgggtcgttcacggagatgacgcagatcttc
accgagatgagcgagccgccgacgccgcaggtcgacgggacgccccggcgcatcgggatc
ctgcacgccggcggtctcgcccccggcatgaacaccgccgcccgggccgccgtccgcctc
gggctcgaccgcggccacaccatgctggggatccagggcggctacccagggctgcgggac
ggcgacatccgcgagctggcctggggcgacgtggaggggtggaccgcgatcggcggcgcc
gagctgggggtccgccgcagcctgccggaggtggagcacctctacccgatcgggcgggcg
ctggaggagcaccgggtggacgcgctgctcgtcatcggcggctggaacgcctacgtcggc
gcccagacgctgtggcaggagcgggaccgctacccggcgttccggatacccatggtgtgc
gtgcccgcctccatcgataacaacctgccggggtccgagctcgccgtcggcgcggacacc
gcgctcaacgcgatcgtggacgcgctggaccggatcaagcagtccgcgtccgcacgccgg
cgctgcttcgtcgtggagacgatgggccgctactgcggctacctcgcgctgatgggcggc
ctcgccgggggcgccgagcgcgtctacctccacgaggagggcatcaccctggacgacctg
cagcgggacgtgcagcggctgcggtcctccttcgacgcggggcgccggctcttcctcgcg
gtgcgcaacgagcgctcctcggagcagtacaccctggacttcctcgcccggctcttcgac
caggaggggcaggagcggtatgacgtccgccaggcggtgctggggcacgtccagcagggg
ggcgacccgtcaccgttcgaccggatcctggccacccggctggtcgctcacgcgatcgac
ctgctgaccggggagctggccgccggtgggcaggaggcgcagctcgtcggcctggtccgc
ggtcgcgtccgggccacgccgctcgcccggatgccggagctcatggacctcgtccaccgg
cgtccccgggaccagtggtggctggacctgcggccggtcgtccgggcggtgtcggagccg
ggagccgctgcgccgacggggctctga

DBGET integrated database retrieval system