KEGG   Arsenicicoccus sp. oral taxon 190: ADJ73_04475Help
Entry
ADJ73_04475       CDS       T04014                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
ars  Arsenicicoccus sp. oral taxon 190
Pathway
ars00250  Alanine, aspartate and glutamate metabolism
ars00410  beta-Alanine metabolism
ars00640  Propanoate metabolism
ars00650  Butanoate metabolism
ars01100  Metabolic pathways
ars01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ars00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    ADJ73_04475
   00650 Butanoate metabolism
    ADJ73_04475
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ADJ73_04475
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ADJ73_04475
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ars01007]
    ADJ73_04475
Enzymes [BR:ars01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     ADJ73_04475
Amino acid related enzymes [BR:ars01007]
 Aminotransferase (transaminase)
  Class III
   ADJ73_04475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 DUF2724
Motif
Other DBs
NCBI-ProteinID: AKT50748
UniProt: A0A0K1F8A0
LinkDB All DBs
Position
1:complement(936663..937919)
Genome map
AA seq 418 aa AA seqDB search
MTSLSPLLKQATPVVVDHASGCWIHGQDGRDYLDFTTGIGVTSTGHCHPRVVEAAREQVG
KIIHAQYTTVMHQPLLDLTERLGQVLPEGLDSVFYANSGSEAVESAVRLARMATGRPNIV
VFQGGFHGRTVAAATLTTAGTRFAAGFSPLMGGVHMAPFPYAYRYGWDVDTAIDFALREL
DHLFATRTSPADTAAFLIEPVLGDGGYLPTPPRFLQGLRERADEHGILLVLDEVQAGCGR
TGRFWGHQHADVAPDILLTAKGIASGFPISAMAASEALMSRGWPGSQGGTYGGNAVAAAA
GCATLDVIRDEGLVDNARVRGDQLRAGLDALAADVDAIGDVRGLGLMQGIEFTTADGRPD
AATALAVQQGTTAHGLLTLTCGPLGNVVRVMPALVVSEEEIELGLQRFRATVEEVVPG
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgacctccctgagccctctcctcaagcaggccacacccgtcgtggtcgaccacgcctcc
ggctgctggatccatggtcaggacggccgtgactacctcgacttcaccacgggcatcggc
gtcaccagcaccggccactgccacccgcgggtcgtcgaggccgcccgcgagcaggtcggc
aagatcatccacgcgcagtacacgacggtgatgcaccagccgctgctcgacctcaccgag
cggctcggccaggtcctcccggaggggctcgactcggtcttctacgccaactccggctcc
gaggccgtggagtcggcggtgcggctggcccgcatggcgaccggacgccccaacatcgtg
gtcttccagggcggcttccacggccgcacggtcgcggcggcgaccctcacgaccgcgggc
acccgcttcgcggccggcttctccccgctcatgggcggggtgcacatggcgcccttcccc
tacgcctaccgctacggctgggacgtcgacaccgcgatcgacttcgcgctgcgcgagctg
gaccacctcttcgcgacccgcacctccccggccgacaccgcggccttcctcatcgagccg
gtgctcggggacggcggctacctgccgaccccgccgcgcttcctgcaggggctgcgcgag
cgcgccgacgagcacggcatcctgctggtgctcgacgaggtgcaggccggctgcgggcgg
accggccggttctgggggcaccagcacgccgacgtcgcgcccgacatcctgctgaccgcc
aagggcatcgcgtcgggcttccccatcagcgcgatggccgcctccgaggcgctcatgagc
aggggctggcccggctcccagggcgggacgtatggcggcaacgccgtggccgcggccgcc
ggctgcgcgaccctcgacgtgatccgggacgaggggctcgtggacaacgcgcgggtccgc
ggggaccagctgcgggcggggctcgacgcgctggccgccgacgtcgacgcgatcggcgac
gtgcgcggcctggggctgatgcagggcatcgagttcaccaccgccgacgggcgccccgac
gcggcgaccgcgctcgcggtgcagcagggcacgaccgcccatggtctgctcaccctcacc
tgcggtccgctcggtaacgtcgtccgggtgatgcccgcgctcgtcgtctccgaggaggag
atcgagctggggctgcagcgcttccgcgccacggtcgaggaggtcgtcccgggctga

DBGET integrated database retrieval system