KEGG   Arsenicicoccus sp. oral taxon 190: ADJ73_08970Help
Entry
ADJ73_08970       CDS       T04014                                 

Definition
(GenBank) superoxide dismutase
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
ars  Arsenicicoccus sp. oral taxon 190
Brite
KEGG Orthology (KO) [BR:ars00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ADJ73_08970
Enzymes [BR:ars01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     ADJ73_08970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni Alliinase_C
Motif
Other DBs
NCBI-ProteinID: AKT51416
UniProt: A0A0K1FAF3
LinkDB All DBs
Position
1:complement(1900927..1901319)
Genome map
AA seq 130 aa AA seqDB search
MFTFAPVEVSAHCDLPCGVYDPAQARIEAQSVKAIMEKVADNADPDFKIRATIIKEQRSQ
LVKEHLWVLWTDYFKPPHFEKFPQLHTLVNEATKLAGASGTKGEWDVSKADELLAKIDEI
AAIFAETKKG
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgttcacgttcgcccccgtcgaggtgtctgcgcactgcgacctgccctgtggcgtctac
gaccccgcacaggcccgcatcgaggcccagtcggtcaaggccatcatggagaaggtcgcc
gacaacgccgaccccgacttcaagatccgcgccaccatcatcaaggagcagcgctcccag
ctggtcaaggagcacctgtgggtgctgtggaccgactacttcaagccgccgcacttcgag
aagttcccgcagctgcacaccctcgtcaacgaggccaccaagctggcgggcgcgtccggc
accaagggtgagtgggacgtcagcaaggccgacgagctgctcgccaagatcgacgagatc
gccgcgatcttcgccgagaccaagaagggctga

DBGET integrated database retrieval system