KEGG   Arsenicicoccus sp. oral taxon 190: ADJ73_13190Help
Entry
ADJ73_13190       CDS       T04014                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ars  Arsenicicoccus sp. oral taxon 190
Brite
KEGG Orthology (KO) [BR:ars00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ADJ73_13190
Enzymes [BR:ars01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     ADJ73_13190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_3 GIDA Thioredoxin_3 FAD_oxidored K_oxygenase FAD_binding_3 Glutaredoxin FAD_binding_2 FMO-like NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AKT52850
UniProt: A0A0K1FDS8
LinkDB All DBs
Position
1:complement(2816476..2818029)
Genome map
AA seq 517 aa AA seqDB search
MTTQVKGLLANVKEPIELVASLDDRPKAEEMRQLLQELAALSDQVSLRTDGTADRRPSFR
IERTGTDVGVEFAGIPLGHEFTSLVLALLQVGGHPVKEDAELIEQVQALEGEHEFVTYMS
LSCQNCPTVVQALNAMAVLNPRIKHTAVEGSLFQDEIEEHGIKAVPTVYRDGELFESGRM
TMADIVGRIDSGAADRATDRLNAKEPYEVLVVGSGPAGAAASIYTARKGIRTGLVGERFG
GQVLDTMAIENFVSVPYTEGPRFADALKDHVGQYDVDVVTGPLATELVPADVEGGYHTVR
FGNAELKARSVVLSTGARWRHMGVPGEEEYRNKGVTFCPHCDGPLFKGKRIAVIGGGNSG
VEAAIDLAGVVGHVTLIEFLDVMRADQVLQDKLRSLPNVDVVLSARTTEVVGDGKQVTGL
RYEDRTTGAAHELALEGIFVQIGLLPNTEWLRGAVELSDRGEVVVDEMGRTSVPGVLGAG
DCTTVPYKQIVVAQGAGATAALSAFDHLIRTPAPASA
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgcaggtcaagggcctgctcgccaacgtcaaggagcccatcgagctggtggcg
tccctcgacgaccgccccaaggccgaggagatgcgccagctgctccaggagctcgcggcg
ctgtccgaccaggtgagcctgcgcaccgacggcaccgccgaccggcgcccgtccttccgc
atcgagcgcaccggcaccgacgtcggggtggagttcgcgggcatcccgctggggcacgag
ttcacctccctggtgctggcgctgctgcaggtcggcggccacccggtcaaggaggacgcc
gagctgatcgagcaggtccaggcgctggagggcgagcacgagttcgtcacctacatgtcg
ctgtcgtgccagaactgcccgaccgtcgtgcaggcgctcaacgcgatggcggtgctcaac
ccccggatcaagcacaccgccgtcgaaggcagcctcttccaggacgagatcgaggagcac
ggcatcaaggccgtcccgaccgtctaccgcgacggcgagctcttcgagtccggccggatg
accatggccgacatcgtggggcgcatcgactccggcgcggcggaccgcgccacggaccgc
ctcaacgccaaggagccctacgaggtcctggtcgtcggctccggcccggcgggcgccgcc
gcgtcgatctacacggcccgcaaggggatccgcaccggcctggtgggggagcgcttcggc
ggccaggtgctcgacaccatggcgatcgagaacttcgtgtccgtcccctacaccgagggc
ccccgcttcgcggacgccctcaaggaccacgtgggccagtatgacgtcgacgtggtcacc
ggccccctcgcaaccgagctggtccccgccgacgtcgagggcggctaccacacggtccgc
ttcggcaacgccgagctgaaggcccgctccgtcgtgctgtccaccggcgcgcgctggcgc
cacatgggcgtccccggcgaggaggagtaccgcaacaagggcgtcaccttctgcccgcac
tgcgacggccccctcttcaagggcaagcgcatcgcggtgatcggcggcggcaactccggc
gtcgaggccgccatcgacctggccggggtcgtcgggcacgtcacgctcatcgagttcctc
gacgtcatgcgcgccgaccaggtgctgcaggacaagctgcgcagcctgcccaacgtcgac
gtcgtcctgtccgcccgcaccaccgaggtcgtcggcgacggcaagcaggtcaccggcctg
cgctacgaggaccgcaccaccggcgccgcccacgagctcgcgctggagggcatcttcgtg
cagatcgggctgctgcccaacaccgagtggctccgcggcgccgtcgagctgtccgaccgc
ggcgaggtcgtcgtcgacgagatgggtcgcacctcggtgccgggcgtcctcggcgccggc
gactgcaccaccgtgccctacaagcagatcgtcgtcgcgcagggcgccggggccaccgcc
gcgctgtccgccttcgaccacctgatccgcacccccgcgccggcctcggcgtga

DBGET integrated database retrieval system