KEGG   Arsenicicoccus sp. oral taxon 190: ADJ73_15755Help
Entry
ADJ73_15755       CDS       T04014                                 

Definition
(GenBank) ATP F0F1 synthase subunit beta
  KO
K02112  F-type H+/Na+-transporting ATPase subunit beta [EC:7.1.2.2 7.2.2.1]
Organism
ars  Arsenicicoccus sp. oral taxon 190
Pathway
ars00190  Oxidative phosphorylation
ars01100  Metabolic pathways
Module
ars_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:ars00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ADJ73_15755
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:ars00194]
    ADJ73_15755
Enzymes [BR:ars01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.1.2.2  H+-transporting two-sector ATPase
     ADJ73_15755
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.1  Na+-transporting two-sector ATPase
     ADJ73_15755
Photosynthesis proteins [BR:ars00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   ADJ73_15755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_ab ATP-synt_ab_N AAA_25 RsgA_GTPase AAA AAA_19 ATPase ATPase_2 ABC_tran DUF2806 AAA_16 NACHT NB-ARC LRV_FeS
Motif
Other DBs
NCBI-ProteinID: AKT52367
UniProt: A0A0K1FD61
LinkDB All DBs
Position
1:complement(3374718..3376178)
Genome map
AA seq 486 aa AA seqDB search
MTATMNEAQQGAPAEGGVGRVSRSIGPVVDVEFPVDAMPEMYNLLKVDVELGGETKTLNL
EVAQHIGDNLVRAVSLQPTDGLVRGAAVRDTGGPISVPVGDVTLGKVFNATGDCLNLEEG
EHLEVNERWGIHRPAPAFDQLESKTQMFQTGIKVIDLLTPYVQGGKIGLFGGAGVGKTVL
IQEMIARVARDHGGVSVFAGVGERTREGNDLMVEMEEAGVLGQTSLVFGQMDEPPGTRLR
VALSALTMAEYFRDVQKQDVLLFIDNIFRFTQAGSEVSTLLGRMPSAVGYQPTLADEMGV
LQERITSTRGHSITSMQAIYVPADDYTDPAPATTFAHLDATTELSRDIASMGIYPAVDPL
TSTSRILDPRYIAQDHYDTAVRVKGILQRNKELQDIIAILGMDELSEEDKILVNRARRIQ
RFLSQNTYVAKQFTGIEGSTVPLEDTIEAFTKICDGEYDHVAEQAFFMCGGLDDVERQWA
EIQKSL
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgactgccaccatgaacgaggcccagcagggcgcccccgccgagggcggcgtcggtcgg
gtctcccgctccatcggcccggtcgtcgacgtggagttccccgtcgacgccatgcctgag
atgtacaacctgctcaaggtcgacgtcgagctcggcggcgagaccaagacgctcaacctc
gaggtcgcccagcacatcggtgacaacctcgtgcgcgccgtctccctgcagcccaccgac
ggcctggtgcgcggcgcggcggtgcgcgacaccggcggcccgatcagcgtgcccgtcggc
gacgtgacgctcggcaaggtcttcaacgccaccggtgactgcctcaacctggaggagggc
gagcacctcgaggtcaacgagcgctggggcatccaccgcccggcgccggccttcgaccag
ctcgagtccaagacccagatgttccagacgggcatcaaggtcatcgacctgctgaccccc
tacgtccagggtggcaagatcggcctcttcggcggcgccggcgtgggcaagacggtgctc
atccaggagatgatcgcccgtgtcgcccgtgaccacggtggtgtgtcggtcttcgccggt
gtcggtgagcgcacccgtgagggcaacgacctgatggtcgagatggaggaggcgggcgtc
ctcggtcagacctcgctcgtcttcggccagatggacgagccgccgggcacgcgtctgcgc
gtggccctgtccgccctgacgatggcggagtacttccgcgacgtgcagaagcaggacgtg
ctgctcttcatcgacaacatcttccgcttcacgcaggccggctcggaggtctcgacgctg
ctgggtcgcatgccgtcggccgtgggttaccagcccaccctcgccgacgagatgggtgtg
ctccaggagcgcatcacctccacgcgcggtcactcgatcacctcgatgcaggcgatctac
gtgccggcggacgactacaccgacccggccccggccacgaccttcgcccacctcgacgcg
accacggagctctcccgtgacatcgcctcgatgggtatctacccggccgtggacccgctg
acgtcgacctcccgcatcctcgacccgcgctacatcgcgcaggaccactacgacacggcg
gtccgcgtcaaggggatcctgcagcgcaacaaggagctgcaggacatcatcgcgatcctc
ggcatggacgagctcagcgaggaggacaagatcctcgtcaaccgcgctcgccgcatccag
cgcttcctgtcccagaacacctacgtcgccaagcagttcaccggcatcgagggttccacg
gtgccgctggaggacacgatcgaggcgttcaccaagatctgcgacggcgagtacgaccac
gtcgccgagcaggccttcttcatgtgcggtggcctcgacgacgtcgagcgccagtgggcg
gagatccagaagtctctctga

DBGET integrated database retrieval system