KEGG   Arsenicicoccus sp. oral taxon 190: ADJ73_15985Help
Entry
ADJ73_15985       CDS       T04014                                 

Definition
(GenBank) trehalose synthase
Organism
ars  Arsenicicoccus sp. oral taxon 190
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: AKT52396
UniProt: A0A0K1FD88
LinkDB All DBs
Position
1:complement(3425036..3426712)
Genome map
AA seq 558 aa AA seqDB search
MRITETGDLWWKNAVIYSLDVEAYNDGNGDGVGDFNGLAGRIDYLAELGVTCLWLMPFFP
SPDKDDGYDITDFYGVDPRLGSLGDFVEVTRTAHDRGIRVIIDLVINHTSDQHPWFTESR
KSTDNPYRDWYVWRSDTPPDTSDKVVFPDQEDSIWEKDDKTGEWYLHNFYRFQPDLNIAN
PKVRDEILKIIGFWAELGVDGFRIDAVPFIFSTEGNRPEEKKAFGDPQDFLRDIRALVGR
RIGDGIILGEVNIPYPDQYTYFGGEHGDGLTMQFDFIGMQATYLSLARQDPEPLLTALKA
RPTLSHGTQWANFLRNHDELTLDKLSDSERQEVFDAFGPEPEMQVYGRGLKRRLPSMLDG
DPRRIRMAYSLLFSLPGTPSLFYGEEIGMGEVLSEEGRMAVRTPMQWTSQSSAGFSTAPV
RKLVAPLPKDGYSPEHVNVADQRYDRESLYAFMRELIFRYRQHPELGWGRHEVLEQPHRS
VLALRIRHEDSSVVTVHNLGAEGATVELTIEEEPGSVLVDIFGGDRCELQEDGRLQVVLD
GYGFRWYGVHGPHDRRLY
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcaccgagaccggcgacctgtggtggaagaacgccgtcatctacagcctcgac
gtcgaggcctacaacgacggcaacggtgacggggtcggtgacttcaacggcctggccggc
cgcatcgactacctcgccgagctgggcgtcacgtgcctgtggctcatgcccttcttcccc
tcgccggacaaggacgacggctacgacatcaccgacttctacggcgtcgacccgcggctc
ggcagcctgggcgacttcgtggaggtcacccgcaccgcccacgaccgcggcatccgcgtg
atcatcgacctggtgatcaaccacacctcggaccagcacccgtggttcacggagtcccgc
aagagcacggacaacccctaccgggactggtacgtctggcgctcggacaccccgccggac
acctccgacaaggtggtcttccccgaccaggaggactcgatctgggagaaggacgacaag
acgggggagtggtacctccacaacttctacaggttccagcccgacctcaacatcgccaac
cccaaggtccgcgacgagatcctcaagatcatcggcttctgggccgagctgggggtcgac
ggcttccgcatcgacgcggtgccgttcatcttctccacggagggcaaccggcccgaggag
aagaaggccttcggcgacccgcaggacttcctgcgcgacatccgcgccctcgtcgggcgt
cggatcggggacgggatcatcctcggcgaggtcaacatcccctaccccgaccagtacacc
tacttcgggggcgagcacggcgacggcctgacgatgcagttcgacttcatcgggatgcag
gccacctacctgtccctggcccgccaggacccggagccgctgctcacggccctcaaggcc
cgcccgacgctgtcccacggcacccagtgggccaacttcctgcgcaaccacgacgagctg
acgctggacaagctgtcggactccgagcgtcaggaggtcttcgacgccttcggccccgag
cccgagatgcaggtctatggccgcggcctcaagcgccggctcccgtcgatgctcgacggc
gacccccgccggatccgcatggcctactcgctgctcttctccctgcccggcaccccgtcc
ctcttctacggcgaggagatcgggatgggcgaggtcctctccgaggagggccggatggcg
gtgcgcacccccatgcagtggacctcccagtcgagcgcaggcttctccaccgccccggtc
cgcaagctggtggcgccgctgcccaaggacggctactccccggagcacgtcaacgtcgcc
gaccagaggtacgaccgcgagtcgctgtacgccttcatgcgggagctgatcttccgctac
cgccagcaccccgagctcgggtgggggcggcacgaggtgctggagcagccgcaccgctcg
gtcctggcgctgcgcatccgccacgaggacagcagcgtggtgaccgtgcacaacctcggc
gccgagggtgccaccgtggagctgaccatcgaggaggagcccggctcggtcctcgtggac
atcttcggcggcgaccgctgcgagctgcaggaggacggccggctgcaggtggtcctcgac
ggctacggcttccggtggtacggcgtgcacggcccccacgaccgccggttgtactga

DBGET integrated database retrieval system