KEGG   Arthrobacter sp. FB24: Arth_1092Help
Entry
Arth_1092         CDS       T00421                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
art  Arthrobacter sp. FB24
Pathway
art00020  Citrate cycle (TCA cycle)
art00480  Glutathione metabolism
art01100  Metabolic pathways
art01110  Biosynthesis of secondary metabolites
art01120  Microbial metabolism in diverse environments
art01130  Biosynthesis of antibiotics
art01200  Carbon metabolism
art01210  2-Oxocarboxylic acid metabolism
art01230  Biosynthesis of amino acids
Module
art_M00009  Citrate cycle (TCA cycle, Krebs cycle)
art_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:art00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Arth_1092
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Arth_1092
Enzymes [BR:art01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Arth_1092
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: ABK02486
UniProt: A0JTW6
LinkDB All DBs
Position
1180188..1182410
Genome map
AA seq 740 aa AA seqDB search
MAKIIYTHTDEAPMLATYSFLPIVEAYASTAGVEVETRDISLSGRIISVFGDYLTEEQRI
SDALAELGDLAKKPEANIIKLPNISASIPQLKAAIAELQSQGYDLPDYPDNPSSDTETDI
RSRYDKIKGSAVNPVLREGNSDRRAPLSVKNYARQNPHSMGAWSPESKTNVATMGADDFR
ANEKSVVIESDDTVKIQLVREDGTVKVLKRGFPVLAGEVVDGTVMRAAALDEFLAAQVAR
AKEEGVLFSAHLKATMMKVSDPIIFGHVVKAYFTELFDTYGEQLAAAGLSPNNGLASILG
GLEELPEDVREGVQAAIKKGLAEGPALAMVDSDKGITNLHVPSDVIVDASMPAMIRSSGH
MWGPDGKEADTLAVLPDSSYASIYQVVIDDCRAHGAFDPTTMGTVPNVGLMAQAAEEYGS
HDKTFEIQSAGTVQLVDSKGTVLIEHQVAPGDIWRACQAKDVPIRDWVKLAVTRARASEM
PAVFWLDETRAHDANLIAKVKEYLKDYDTEGLQIEIMSPEKATAFTLERIRKGEDTISVT
GNVLRDYLTDLFPILELGTSAKMLSVVPLINGGGLFETGAGGSAPKHVQQLLKENHLRWD
SLGEFLALAVSFEHLATTTGNKRAQVLADTLDRATGTFLLENKSPRRSVGELDNRGSHFY
LAKFWAQELAKQTDDAELAADFAAVSEALTSNEDTIIAELLAVQGSPVDIGGYYHPDVAK
VASVMRPSAKFTEVLSGLTK
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atggccaagattatctatacccacacagacgaagcgcccatgctggccacctattcgttc
ttgccgatcgtcgaggcctacgcgtcgactgccggtgtggaagtggagacccgcgacatc
tcgctctctggccgcatcatttcggtgttcggtgactacctcaccgaagagcagcggatc
agcgatgccctggccgaactgggcgacctggcaaagaagcccgaagccaacatcatcaag
ctgcccaacatcagcgcttccattccgcagctgaaggcagccatcgccgaactccagtcc
cagggctacgacctcccggactacccggacaacccgtcctccgacaccgagacggacatc
cgctcacgctacgacaagatcaagggttcggccgtcaacccggtcctgcgcgaaggcaac
tcggaccgccgcgcgcccctctccgtgaagaactacgcccgccagaacccgcactccatg
ggcgcctggtcgccggagtccaagaccaatgtggccacgatgggcgctgatgacttccga
gccaacgagaagtccgtggtcatcgagtccgatgacaccgtcaagatccagctggtcagg
gaagacggcaccgtcaaggtcctgaagcgcggattccccgtcctggccggcgaagttgtt
gacggcaccgtgatgcgcgccgccgccctggatgaattcctggctgcccaggttgcccgc
gccaaggaagagggcgtgctgttctccgcacacctgaaggccaccatgatgaaggtctcg
gatcccatcatcttcggccacgtggtcaaggcctatttcaccgaactgttcgacacgtac
ggcgagcagctcgccgccgccggcctcagccccaacaacggcctggcctccatccttggc
ggactcgaagagctcccggaagacgtccgtgagggcgtccaggcagccatcaagaagggc
ctcgcagagggtcccgcgctggccatggtggactcggacaagggcatcaccaacctgcac
gttccctccgacgtcatcgtggacgcctccatgcccgccatgatccgctcctccggccac
atgtggggcccggacggcaaggaagccgacacgctggccgttcttccggacagcagctat
gcaagcatctaccaggtcgtcattgacgactgccgcgcccacggcgccttcgaccccacc
accatgggcaccgtgccgaacgtcggcctcatggcccaggccgcggaggaatacggcagc
cacgacaagacctttgaaatccagtccgccggcaccgtccagctcgtggacagcaagggc
accgtcctgatcgaacaccaggtggcaccgggcgacatctggcgcgcctgccaggccaag
gacgtgccgatccgcgactgggtcaagctcgccgttacccgcgcccgcgcctccgaaatg
cccgctgtgttctggctggatgagacgcgcgcccacgacgccaacctgatcgccaaggtc
aaggaatacctcaaggactacgacaccgagggcctccagatcgagatcatgtccccggaa
aaggccacagccttcaccctcgagcgcatccgcaagggcgaggacaccatctcggtgacc
ggcaacgtgctccgcgactacctcacggaccttttcccgatcctcgaactgggtaccagc
gccaagatgctctccgtggttccgctgatcaacggcggcggactcttcgagaccggcgcc
ggcggatccgccccgaagcacgtccagcagttgctgaaggaaaaccacctgcgctgggac
agtcttggtgagttcctggccctcgccgtcagcttcgagcacctggcgaccaccacgggc
aacaagcgtgcccaggtgctcgccgataccctggaccgcgctaccggcacgttcctgctc
gagaacaagtctccgcgccgcagcgtcggggaactggacaaccgcggcagccacttctac
ctcgccaagttctgggcgcaggagcttgccaagcagaccgacgacgccgagctggccgcc
gacttcgcagctgtctccgaggcgttgacctccaacgaggacacgatcattgccgaactg
ctcgcagtgcagggctccccggtggacatcggtggctactaccacccggacgttgccaag
gtcgcctcggtgatgcgtccgtccgcgaagttcaccgaagttctgtccggcctgaccaag
tag

DBGET integrated database retrieval system