KEGG   Arthrobacter sp. FB24: Arth_1757Help
Entry
Arth_1757         CDS       T00421                                 

Definition
(GenBank) aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
art  Arthrobacter sp. FB24
Pathway
art00250  Alanine, aspartate and glutamate metabolism
art00410  beta-Alanine metabolism
art00640  Propanoate metabolism
art00650  Butanoate metabolism
art01100  Metabolic pathways
art01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:art00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Arth_1757
   00650 Butanoate metabolism
    Arth_1757
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Arth_1757
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Arth_1757
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:art01007]
    Arth_1757
Enzymes [BR:art01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Arth_1757
Amino acid related enzymes [BR:art01007]
 Aminotransferase (transaminase)
  Class III
   Arth_1757
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ABK03149
UniProt: A0JVS9
LinkDB All DBs
Position
complement(1966633..1967910)
Genome map
AA seq 425 aa AA seqDB search
MTSLSPLLKQATPLVVDHALGSWIHATDGKSYLDFTTGIGVTSTGHCHPRVVEAAREQAG
KIIHAQYTTVMHKPLLALTEKLGEVLPEGLDSVFYANSGSEAVEAAIRLARMATGRPNIV
VFQGGFHGRTVAAASLTTAGTKFSAGFSPLMSGVHMSAFPYAYRYGWDEAATVAFALQEL
DYLLQTRTAPNDTAAFLIEPALGDGGYLPTPPAFLEGLRERADRHGIQLIFDEVQAGVGR
MGKFWGHQYSTATPDILITAKGIASGFPISAIAASTETMSKGWPGSQGGTYGGNAVSAAA
GVATLDVVRDEGLVENSRIRGEQLQAGLNDIQARFPVIGDVRGKGLMQGIEFTTEEGTPD
SATAAAVQQATTAEGLLTLTCGPAGNVVRLIPALVVTAEEITTGLQLFEAAVAAVVGSVA
VSAGS
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgacttctcttagccctcttctaaagcaagcaaccccgctggtcgttgatcatgccctt
ggcagctggattcacgccaccgacggcaagtcgtatctggatttcaccaccgggatcgga
gtgactagtaccggtcactgtcatcctcgggtggtggaggctgcccgtgagcaggcgggg
aaaattattcatgcgcagtacacaacggtgatgcataagccgttgctggcgttgaccgag
aagctgggcgaggtgttgccggagggcctggactcggtgttttatgccaattccggttcg
gaagcggtggaggctgcgatccgtctggccaggatggccacgggccggccgaacattgtg
gtgttccaaggtggcttccacggccggaccgtggctgcggcgtcgctgacaacggccggg
acgaagttctccgccgggttctctccgctgatgtccggggtgcacatgtccgcgttccct
tacgcgtaccggtacgggtgggacgaggccgccacggtggcgttcgcgttgcaggaactc
gattatcttttgcagacccgcaccgcgccgaacgataccgcagcgttcctgatcgaaccg
gcactcggtgacggcggatacctgccgacaccgccggcgttcctcgaaggcctgcgtgaa
cgcgcggaccggcacggcatccagctgatctttgacgaggtccaggccggggtgggccgg
atgggcaagttctggggacaccagtactccaccgcgaccccggacatcctgatcaccgcc
aaaggcatcgcttcgggcttcccgatctccgcgatcgccgcctcgaccgaaacgatgtcc
aagggctggcccggctcccagggggggacctacggcggcaacgccgtctccgccgccgct
ggcgtcgcgaccctggacgtcgtccgggacgaagggctcgtggagaactcccggatccgc
ggcgagcaactccaggccgggctaaacgatatccaggcccggttccccgtcatcggggac
gtccggggcaagggcctgatgcagggcatcgagttcaccacggaagaaggtacccccgat
tccgccacggcagccgcggtccagcaggccacgactgccgagggcctgctcaccctcacg
tgcggtcccgcagggaacgtcgtccgcctcatccccgccctcgtggtcaccgccgaagaa
atcaccacaggcctccaactcttcgaagccgccgtcgccgccgtcgtcgggtccgtagcc
gtgtccgctggatcctga

DBGET integrated database retrieval system