KEGG   Arthrobacter sp. FB24: Arth_3325Help
Entry
Arth_3325         CDS       T00421                                 

Definition
(GenBank) Beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
art  Arthrobacter sp. FB24
Pathway
art00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:art00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Arth_3325
Enzymes [BR:art01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Arth_3325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Glyco_hydro_14
Motif
Other DBs
NCBI-ProteinID: ABK04700
UniProt: A0K080
LinkDB All DBs
Position
3733230..3735245
Genome map
AA seq 671 aa AA seqDB search
MSSQENPTPPAVWSSLEGIAYGGDYNPEQWPVSTRQEDLDLMKEAGVTFLSVGIFSWGLL
EPSEGDYDFGWLDDALDNLAAAGIKVALATATAAPPAWLVRKHPEILPVTADGTVLGPGS
RRHYTPSSAVYRRYATGITRVLAERYKDHPALALWHVDNELGCHVSEFYGDEDATAFRRW
LERRYGSIDALNAAWGTAFWSQHYSSFEEVLPPAAAPSTLNPGQQLDFQRFSSWALMDYY
RALLEVLRDVTPGVPATTNLMVSSATKSMDYFDWAKDLDVIANDHYLVAADPERQIELAF
SADLTRGVAGGDPWILMEHSTSAVNWQPRNQPKMPGEMLRNSLAHVARGADAVMFFQWRQ
SFAGSEKFHSAMVPHGGRDTRIFHEVVGLGAALQKLAAVRGSRVESRVAIVFDYEAWWAS
ELDSHPSQDVKYLDLMRAFHRSLFLRGVSTDFVHPSASLEGYDLVLVCTLYNVTDPAAAS
IASAARAGATVLVSYFSGIVDEQDHIRLGGYPGAFRELLGIRVEEFHPLLTGATAKLSDG
RVGTVWSEHVHLAGAEPVQTFTEYPLEGVPALTRRSVGTGSAWYLATFPDRDGIEALVDR
LLADSGVSAVAEADQGVELTRRRTGDGTSFIFAINHSRADATVRVAGAELLSGERFTGTV
PAGGVAVIAED
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcccaggaaaatcccactccacccgcagtgtggagcagcctcgaaggtatcgcc
tacgggggcgactacaaccccgagcagtggcctgtcagcacccggcaggaagacctggac
ctcatgaaggaagccggcgtcacgttcctcagcgtgggcattttttcctggggcctgctg
gaaccgtccgagggcgactacgattttggctggctggacgacgccctggacaacctggca
gcagcaggcatcaaggtggccctcgcgaccgcaaccgccgcgcccccggcatggttggtg
cgcaagcacccggaaatcctcccggtcaccgctgacggaaccgtgctggggccgggctcc
cggcggcactacacgccgtcgtcggccgtttaccggcggtacgcaaccggcatcacccgg
gtgctggcagagcgctacaaggaccacccggcactggcgctgtggcacgtggacaacgaa
ctcggctgccacgtttcggagttctacggcgacgaggacgccactgccttccgccgttgg
cttgagcgtcggtacgggagcatcgatgccctgaacgcggcgtggggaacggcgttctgg
tcccagcactactcctcgttcgaggaggtcctgccgccagcggcggcgccgtccacgctt
aatccggggcagcagctggacttccagcgcttcagctcctgggccctgatggactattac
cgcgccctcctcgaggtgctgcgcgacgtaacgcccggggtgcctgccaccaccaacctc
atggtttccagcgccaccaaatccatggactacttcgactgggccaaggacctggacgtg
atcgccaacgaccactacctcgtggccgccgatccggagcgtcagatcgaacttgcgttc
agtgcggacctcacgcgcggcgttgccggcggtgacccgtggatactgatggaacattcg
acgtcggcagtgaactggcagccccgcaaccagcccaagatgcccggcgaaatgctgcgc
aactccctggcgcacgtggcccgcggcgctgatgccgttatgttcttccagtggcggcag
agcttcgccggttcggagaagttccactccgctatggtgccccacggcggacgggacacc
cgcatcttccacgaggtggtggggctcggcgccgcactccagaagctggccgcggtgcgg
ggatcgcgcgttgagtcgcgcgtggccatcgtcttcgactacgaggcctggtgggccagc
gaactcgattcccaccccagccaggacgtgaaatacctcgacctgatgcgcgccttccac
cgctcgctgttcctgcgcggggtttcgacggattttgtgcacccttccgcctccctggag
ggctacgacctggtgctggtgtgcaccctgtacaacgtcaccgacccggctgccgccagc
atcgcatcggctgcccgcgccggcgcaacagtcctggtgagctatttcagcgggattgtg
gacgaacaggaccacatccgcctcggcgggtacccgggcgccttccgggagctgctgggc
atcagggtggaggaattccaccccctgctgaccggtgccacggccaagctcagcgacggc
cgagtgggcacggtatggagcgagcacgtgcacttggccggggctgaaccggtacagacg
ttcactgaatacccgttggagggcgtccccgccctgacccggcgctccgtcggaacgggc
tcggcctggtacctggccaccttcccggaccgcgacggcatcgaggcgctggtggaccgg
ttgctcgctgattccggagtttccgcagtggcggaggcggaccagggcgttgaactgacg
cgacgccgcaccggcgacggcaccagcttcatcttcgccatcaaccactcacgcgccgat
gccacggtccgcgtggcaggggcagagctgctgtccggcgagcggttcaccggcacggtt
ccggctggcggcgtggcggtgatcgcggaggactga

DBGET integrated database retrieval system