KEGG   Arthrobacter sp. PGP41: C3B78_02985Help
Entry
C3B78_02985       CDS       T05450                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
arth  Arthrobacter sp. PGP41
Pathway
arth00620  Pyruvate metabolism
arth00680  Methane metabolism
arth01100  Metabolic pathways
arth01120  Microbial metabolism in diverse environments
arth01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:arth00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    C3B78_02985
  09102 Energy metabolism
   00680 Methane metabolism
    C3B78_02985
Enzymes [BR:arth01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     C3B78_02985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AUZ33541
UniProt: A0A2L0QV50
LinkDB All DBs
Position
621955..624777
Genome map
AA seq 940 aa AA seqDB search
MAHTAMNPETDLASELRADVRRVSTLLGESLVRQHGPELLDLVEQVRLLTKESKEAARGG
ADATGPWSAHDVVAQVRELLGSLPIGQATDLVRAFAFYFHLANAAEQVHRVRGLRTRAEK
DGWLAKTIADIASQAGPGVLQEVVNGLDVRPIFTAHPTEASRRSVLDKIRKLSDVLAQPT
AEGTTARRRQDRQLAEIIDQMWQTDELRQVRPTPVDEARNAIYYLGSILTDAMPEMLTEF
SDLLSEHGVTLASQDAPIRFGSWIGGDRDGNPNVTAAVTREILQIQNQHAVRISIGMIDE
LISILSNSTALAGADQELLDSIDSDLKNLPGLDKRVLELNAQEPYRLKLTCIKAKLINTG
KRVAAGSNHEHGRDYSGTDELLADLELLERSLRNHSASLAADGALARVRRAIASFGLHLA
TLDIREHADHHHDAVGQLMDRLGGPGLRYAELSREERFEVLGSELASRRPLSGHPIKLDG
AADGTYDVFREIRRALRTYGPDVIETYIISMTRGADDVLAAAVLAREAGLVNLFGEKPYA
KLGFAPLLETVEELRASAEIVDQLLSDPSYRELVRLRGDVQEVMLGYSDSNKESGVMTSQ
WEIHKTQRKLRDVAAKHGVRVRLFHGRGGSVGRGGGPTYDAILAQPNGVLEGEIKFTEQG
EVISDKYSLPELARENLELSLAAVLQGSALHKDPRTSADQRERYGHVMETISDAAFDRYR
NLIDNPDLPAYFMASTPVEQLGSLNIGSRPSKRPDSGAGLGGLRAIPWVFGWTQSRQIVP
GWFGVGSGLKAAREAGNAAQLVEMWENWHFFRSVLSNVEMTLAKTDLDIAGYYVSTLVPE
ELHHIFRSIREEYELTVAEVQNLTGESLLLDAQPTLKRSLEIRDQYLDPISYLQVELLRR
VRAEAADAADGISGAEIDERLQRAMLITVNGVAAGLRNTG
NT seq 2823 nt NT seq  +upstreamnt  +downstreamnt
atggctcacactgcaatgaatcccgaaaccgatcttgcctccgaactgcgggcagatgtc
cgccgcgtctccaccctgctgggagagtcgctggtccgccagcacggacctgagctcctt
gacctggttgagcaggtgcgcctcctcacgaaggaatccaaggaagccgcccgcggcggt
gccgacgccaccggcccgtggagcgcccacgacgtcgtggcccaggtccgcgagcttttg
ggctccctgcccatcgggcaggccaccgacctggtccgtgccttcgccttctacttccac
ctggccaacgcggccgaacaggtgcaccgggtgcgcggcctgcggacccgcgcggaaaag
gacggctggctggccaagacgattgcggacatcgccagccaggccggccccggggtgctg
caggaagtggtcaacggactggacgtccgccccatcttcaccgcccaccccaccgaagcc
tcgcgccggtccgtgctggacaagatccgcaagctctccgacgtgctggcccagcccacc
gccgagggcaccactgcacgccggcgccaggaccgccagctggccgaaatcatcgaccag
atgtggcagactgacgagctccgccaggtccggcccacgccggtggacgaggcccgcaac
gccatttattacctgggcagcatcctcaccgacgcaatgccggaaatgctcaccgaattc
tcggacctgctcagcgaacacggcgtgaccctcgcatcccaggacgcccccatccgcttc
ggctcgtggatcggcggcgaccgggacggcaaccccaatgtcaccgccgcggtcacccgc
gagatcctccagatccagaaccagcatgcggtgcgcatcagcatcggcatgatcgacgaa
ctgatctccatcctgtccaactccactgcgctcgcaggtgcggaccaggaactgctggac
tccatcgactcggacctgaagaacctgccgggcctggacaagcgcgtcctggagctcaac
gcacaggagccctaccgactgaagctcacctgcatcaaggccaagctgatcaacaccggc
aagagggtggcggccggatccaaccacgagcacggccgcgactacagcggaaccgatgaa
ctcctcgcggaccttgaactgctggagcgctcgctccgcaaccactcggcgtcactggct
gccgacggcgcactggcccgggtccgccgcgccatcgcgtcgttcgggctccacctggcc
accctggacatccgcgagcacgccgaccaccaccatgacgccgtcggccagctgatggac
cgcctgggcggccccggcctgcggtatgcggagctcagccgcgaggagcgctttgaggtg
ctgggttcagagctcgcctcgcgccggccgctgtccgggcacccgatcaagctcgacggc
gccgctgatggcacgtacgacgtcttccgtgagatccgccgcgcgctgcgcacgtacggc
ccggatgtcatcgagacctacatcatctccatgacccgtggcgcggatgacgtcctggcc
gcagccgtcctggcccgtgaggccggcctggtgaacctgtttggcgagaagccctacgcc
aagctcgggtttgcgcccctgctggagaccgttgaggagctgcgggcctccgccgagatc
gttgaccagctgctgtccgatccctcctaccgcgaactggtccggctgcgcggggacgtc
caggaagtcatgctgggctactcggactccaacaaggaatccggcgtgatgaccagccag
tgggagatccacaagacccagcgcaagctgcgggacgtcgccgccaagcatggcgtgcgc
gtgcgcctgttccatggccgcggcggctccgtgggccgcggcggcggacccacgtacgat
gccatcctggcgcagcccaacggcgtgctggaaggcgagatcaagttcacggaacagggc
gaggtcatctcggacaaatactccctgcccgagctcgcccgcgaaaaccttgagctgtct
ttggccgccgtgctgcagggctcggccctgcacaaggacccgcgcacctccgccgaccag
cgggaacgctacgggcacgtcatggagaccatttccgacgcggctttcgaccgctaccgg
aacctgatcgacaaccccgaccttccggcctacttcatggcctccaccccggtggagcaa
ctgggctcgctgaacatcggctcacggccgtccaagcgaccggattccggtgcggggctc
ggcggcctgcgtgccatcccttgggtgttcggctggacccagtcccgccagattgtcccc
ggctggttcggcgtgggctcgggcctgaaggcggcccgcgaggccggcaacgcggcccag
ctcgtggaaatgtgggaaaactggcatttcttccggtcggtgctctccaacgtggagatg
accctcgccaagacggacctggacatcgccggctactacgtctccaccctcgtccccgag
gaactgcatcacatcttccggtccatccgggaggagtacgagctgaccgttgccgaggtc
cagaacctgaccggcgaaagcttgctcctggacgcccagcccacgctcaagcgttcactc
gagatccgggaccagtacctggatccgatcagctacctgcaggtggagctcctgcgccgc
gtccgggctgaggcggctgacgccgctgacggcatcagcggagccgaaattgacgaacgc
ctccagcgcgccatgctgatcaccgtcaacggcgtggcagccgggctccggaacacgggc
tag

DBGET integrated database retrieval system