KEGG   Arthrobacter sp. PGP41: C3B78_06770Help
Entry
C3B78_06770       CDS       T05450                                 

Definition
(GenBank) aspartate aminotransferase
  KO
K00812  aspartate aminotransferase [EC:2.6.1.1]
Organism
arth  Arthrobacter sp. PGP41
Pathway
arth00220  Arginine biosynthesis
arth00250  Alanine, aspartate and glutamate metabolism
arth00270  Cysteine and methionine metabolism
arth00330  Arginine and proline metabolism
arth00350  Tyrosine metabolism
arth00360  Phenylalanine metabolism
arth00400  Phenylalanine, tyrosine and tryptophan biosynthesis
arth00401  Novobiocin biosynthesis
arth01100  Metabolic pathways
arth01110  Biosynthesis of secondary metabolites
arth01130  Biosynthesis of antibiotics
arth01210  2-Oxocarboxylic acid metabolism
arth01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:arth00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    C3B78_06770
   00270 Cysteine and methionine metabolism
    C3B78_06770
   00220 Arginine biosynthesis
    C3B78_06770
   00330 Arginine and proline metabolism
    C3B78_06770
   00350 Tyrosine metabolism
    C3B78_06770
   00360 Phenylalanine metabolism
    C3B78_06770
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    C3B78_06770
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    C3B78_06770
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:arth01007]
    C3B78_06770
Enzymes [BR:arth01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     C3B78_06770
Amino acid related enzymes [BR:arth01007]
 Aminotransferase (transaminase)
  Class I
   C3B78_06770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AUZ34188
UniProt: A0A2L0QX11
LinkDB All DBs
Position
complement(1495681..1496847)
Genome map
AA seq 388 aa AA seqDB search
MAGMPELAAHVRDVPVNQIREITEAAWRTPGALVLSIGEPGFALPRHVLDAGMACLDRDE
TNYTPNAGIPGLREAFAARFREQQGCDIAADRVYVVDGAQQGLHFAMSLLLSPGDEILVP
NPGYPTFAMTSRLLNAVPVGYPLYLEHGFQPRPGDIESLVTDRTRVLVLNSPSNPLGAVL
AEDLTRELMDLARRHDLWVISDECYEAFTYDVPHISPARFDGDTPENSRVFTSLTLSKTY
GLTGLRIGALICPPGIKQEMDNVMESIVSCVASPSQYAALAALTGPQDYVLHAHRHYRAN
RDAASAVLDAKGIPYLKAQGAFYLWADVSHASGGDVRSWVRRFLSDSGVALAPGTAFGSI
GEGWVRVALCGKQDDLVAGLNRLPGRRG
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcatgcctgagcttgccgcccatgtccgcgacgtgcccgtcaaccagatccgc
gagattaccgaagccgcatggcggactcccggcgccctggtgctcagcattggcgaaccc
ggctttgcgctcccccggcatgtcctggacgcaggcatggcatgcctggacagggacgag
accaactacacgcccaacgcgggcatcccggggttgcgcgaggccttcgcggcccggttc
cgggagcagcagggctgcgatattgccgcggaccgggtgtatgtggtggacggggcgcag
cagggcctgcactttgccatgagcctgctgctctcccctggcgacgaaatcctggttccc
aaccctggctatcccacctttgccatgaccagccgcctgctgaacgctgtaccggtgggc
tatccgttgtacctggagcacggcttccagcccaggcccggcgatattgagtcgctggtc
accgaccggacccgggtgctggtcctgaactccccctccaatccgctcggcgccgtgctg
gccgaggacctgacccgggaactcatggacctggcccggcggcatgatctgtgggtcatc
tcggatgaatgctacgaggcgttcacctacgatgtgccgcacatcagccccgccaggttc
gacggcgatacgccggaaaattcccgcgtctttacttcgctgaccctgtccaagacgtac
gggctcaccgggctgcggatcggcgcgctgatttgcccgcccggcatcaagcaggagatg
gacaacgtaatggagtcgatcgtctcctgcgtcgcgtcaccgtcgcagtacgccgcgctc
gccgccctgaccggaccgcaggactacgtcctgcacgcgcaccggcactaccgggcaaac
cgggacgcggcatccgccgttctcgatgccaagggaatcccttacctgaaggcacaggga
gccttctatttgtgggccgatgtttcccacgccagcggcggggacgtccgcagctgggtg
cgccgcttcctctcggactccggggttgccctggcgcccgggactgcgttcggttccatc
ggcgagggctgggtccgggttgcgctgtgcgggaagcaggatgacctcgtggcgggcctg
aaccggctgcccggccgtcgtggctga

DBGET integrated database retrieval system