KEGG   Arthrobacter sp. PGP41: C3B78_08260Help
Entry
C3B78_08260       CDS       T05450                                 

Definition
(GenBank) hypothetical protein
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
arth  Arthrobacter sp. PGP41
Pathway
arth00040  Pentose and glucuronate interconversions
arth00051  Fructose and mannose metabolism
arth01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:arth00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    C3B78_08260
   00051 Fructose and mannose metabolism
    C3B78_08260
Enzymes [BR:arth01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     C3B78_08260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AUZ34446
UniProt: A0A2L0QXQ6
LinkDB All DBs
Position
1827802..1828794
Genome map
AA seq 330 aa AA seqDB search
MAFTIESETQMTDVKYSTRLNSFGLGKGKKYPSGEDSVIDLIAVAGSVKGLTSLELNYPE
HFGQHSVEEIKAALDKADLDVRGIQLRWPAPQFSNGGFTNPDPALREAAVAMVKEAISLC
REFGSDHVLLWPAHDGYEYPLQMDYMKSWNWMVESLQAVADVDQDIRISIEYKPAEPRGR
TILNTTGAVMNLIKDCDRPNLGITLDFGHLLMARENPAQSAAMCLREQKLFGLQLNDSHG
VADDGLVVASIHFAETLELVYYLLREGYQGTYYFDTDPVRENPVAECEMNIERMQTIINK
ARDLVKNQPDLPSGDALRSSSVLWSQVVGV
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
gtggccttcacgatcgaaagcgaaacgcagatgacagatgttaagtactccacccgcctt
aattcttttgggctgggcaagggcaagaagtaccccagcggcgaagactcggtgatcgat
ctgatcgctgttgccggaagcgtcaaggggttgacgtcactcgaactgaactacccggag
cacttcggtcagcattcagtagaggaaatcaaggctgctttggacaaggccgatctcgat
gtccggggtatccagctccgttggccggcacctcagttctccaatgggggattcaccaac
cctgacccggcgcttcgcgaagcagcggtcgcaatggtgaaagaagccatcagcttgtgc
cgggaatttggttcggaccatgttctcctgtggccggcgcatgacggttatgaatacccc
ctgcagatggactacatgaagtcctggaactggatggtcgaaagccttcaggcagtcgcc
gatgttgaccaggacatccgtatttcgatcgagtacaagccggccgagccgcgtggacgc
acgattctgaacaccaccggtgcagtcatgaacctcatcaaagattgcgaccgtcccaac
ctcggcatcacgctggacttcggccacctgctgatggcgcgggaaaatccggcgcagtcc
gccgcgatgtgcctgcgggagcagaaactgttcgggctgcagctcaacgactcgcatggc
gtggccgatgacggcctcgtggtagcgtcgatccacttcgcggagacactggaactggtc
tactacctgctccgcgagggatatcagggaacgtactacttcgacaccgatccggttcgg
gagaaccctgtcgctgagtgcgagatgaacatcgagaggatgcagaccatcatcaacaag
gcccgcgacttggtcaaaaaccagccggatcttcccagcggagatgctctgcgctcatcg
tcggttttgtggtcgcaggtagtgggtgtctag

DBGET integrated database retrieval system