KEGG   Arthrobacter sp. PGP41: C3B78_09310Help
Entry
C3B78_09310       CDS       T05450                                 

Definition
(GenBank) aspartate aminotransferase family protein
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
arth  Arthrobacter sp. PGP41
Pathway
arth00250  Alanine, aspartate and glutamate metabolism
arth00410  beta-Alanine metabolism
arth00640  Propanoate metabolism
arth00650  Butanoate metabolism
arth01100  Metabolic pathways
arth01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:arth00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    C3B78_09310
   00650 Butanoate metabolism
    C3B78_09310
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    C3B78_09310
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C3B78_09310
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:arth01007]
    C3B78_09310
Enzymes [BR:arth01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     C3B78_09310
Amino acid related enzymes [BR:arth01007]
 Aminotransferase (transaminase)
  Class III
   C3B78_09310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AUZ34627
UniProt: A0A2L0QYB7
LinkDB All DBs
Position
complement(2056185..2057438)
Genome map
AA seq 417 aa AA seqDB search
MATLSPILKQATPVIVDHASGSWIHATDGKKYLDFTTGIGVTSTGHCHPDVVAAAREQVG
KIVHAQYTTVMHQPLLELTQLLGDVLPPGLDSVFYATSGSEAVEASVRLARMATGRPNII
SFQGGFHGRTVAAASLTTAGSKFRSGFSPLMSGVHVAPFPHWYRYGWDEATAVEFALKEL
DHLLLTASNPADTAAFIIEPVLGDGGYIPTPVGFLQGLRERADRHGIVLILDEVQAGVGR
TGRFWGHDWAGILPDVVITAKGLASGFPISAIAASAELMGKAWPGSQGGTYGGNAVAAAA
GVATLGVIRRENLVENALLRGDELRAGLDRLQSEFAGIGNVRGRGLMQGVEFTADGNTPD
PVTALAVQQAAVKEELLLLTCGPHGNVIRLIPALNVTSDEIQTGLAKFTQALKTATS
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccctcagccccatcctgaagcaggcgacgcctgtgatcgtcgaccatgcgtcc
ggaagctggatccacgcgaccgacggcaagaagtacctcgacttcaccacaggtattggt
gtcaccagcaccgggcactgccaccctgatgttgtggccgcagcccgcgagcaggtgggc
aagattgtgcacgcccagtacaccaccgtgatgcaccagccgctcctggaactgacgcag
ctgctgggcgacgtccttcccccgggcctggacagcgtcttttatgcaacgtcggggtct
gaagcggtggaggcgtccgtccggctggcccggatggcaaccggccggccgaacatcatc
tccttccagggcggtttccacgggcggacggtggcggcagcttcgctgaccaccgccgga
tcaaaattcaggtcaggtttctcgccccttatgagcggcgtgcacgtcgcacccttcccg
cactggtaccgctacggctgggacgaggcaacggcggtggagttcgcgctgaaggaactc
gaccacctcctcctcaccgccagcaacccggcggatacagccgcgttcatcattgagccc
gtcctgggcgacggcggatacatccccacccccgtcggattcctccagggcctccgcgaa
cgggccgaccgccacggcattgtgctgatcctcgacgaggtccaggccggagtcggccgc
accggcaggttctggggccacgactgggccggcatcctgcccgacgtcgtcatcacggcc
aagggccttgcgagcggattccccatatcggcaattgccgcctcggctgaactgatgggc
aaggcatggcccggctcccagggcggaacgtacggcgggaatgctgtggcagctgcggcc
ggcgtcgccaccctcggcgtcatccggcgcgagaacctggtggagaatgccctgcttcgc
ggcgacgaactgcgcgccgggctcgacaggctgcagtccgaatttgccggcatcggcaac
gtccgcggacggggcctgatgcagggcgtcgagttcaccgccgacggcaataccccggac
ccggtgacggcgctggctgtccagcaggccgccgtcaaggaagaactgctcctcctgacc
tgcggcccccacggcaacgtcatccggcttatcccggccctcaacgtcaccagcgatgaa
atccagaccggcctggcgaagttcacccaggccctcaagacagccacctcctaa

DBGET integrated database retrieval system