KEGG   Arthrobacter sp. PGP41: C3B78_13620Help
Entry
C3B78_13620       CDS       T05450                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
arth  Arthrobacter sp. PGP41
Pathway
arth00220  Arginine biosynthesis
arth00250  Alanine, aspartate and glutamate metabolism
arth00290  Valine, leucine and isoleucine biosynthesis
arth01100  Metabolic pathways
arth01110  Biosynthesis of secondary metabolites
arth01130  Biosynthesis of antibiotics
arth01210  2-Oxocarboxylic acid metabolism
arth01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:arth00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    C3B78_13620
   00290 Valine, leucine and isoleucine biosynthesis
    C3B78_13620
   00220 Arginine biosynthesis
    C3B78_13620
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:arth01007]
    C3B78_13620
Enzymes [BR:arth01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     C3B78_13620
    2.6.1.66  valine---pyruvate transaminase
     C3B78_13620
Amino acid related enzymes [BR:arth01007]
 Aminotransferase (transaminase)
  Class I
   C3B78_13620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AUZ35388
UniProt: A0A2L0R0F4
LinkDB All DBs
Position
complement(2995890..2997110)
Genome map
AA seq 406 aa AA seqDB search
MAEFRQSTKLNNVLYDIRGPILQAAQQMEAEGHRILKLNIGNPAPFGFEAPDAILVDIIR
HLPHAQGYSDSRGIFSARTAVSQYYQTRGIQNIHVDDIYLGNGVSELITMSLMALLDDGD
EVLIPTPDYPLWTASVALAGGKPVHYLCDEESGWQPDLEDMEAKITPRTKGIVVINPNNP
TGAVYPEETLKKIVALAEKHGLVLFADEIYEKILYEDAVHINLAGLTGDDVLCLTFSGLS
KAYRVCGYRAGWMAISGPKKDAADYLEGISLLANMRLCANVPAQHAIQTALGGYQSINDL
ILPGGRLLEQRNKAYDMLNAIPGVSTQQARGALYLFPKLDPEVYHIRDDEKFVLDLLREQ
KILVSHGRAFNWVRPDHFRMVTLPNVKDIEEAVGRMGDFLSRYQGN
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggcagaattcaggcagtccacgaaactcaacaacgtgctttacgacatccgtggaccg
atccttcaggccgcccagcagatggaggcggagggtcaccggatcctcaaactgaacatc
ggaaaccccgcgccgtttggatttgaagcgccggacgccatcctggtggacatcatccgc
cacctgccgcacgcccagggctacagtgactcccgcggcatcttctccgcccggacagca
gtgtcgcagtactaccagacccgcggtatccagaacatccatgtggacgacatctacctg
ggcaacggcgtcagcgagctcatcaccatgtccctgatggccctgcttgatgacggcgac
gaggtcctgatccccacgccggactacccgctctggaccgcctctgtggcgctggccggc
ggcaaacccgtccactacctctgcgacgaggagtccgggtggcagcctgacctagaggac
atggaagccaagatcacgccccgcaccaagggcatcgtggtgatcaacccgaacaatccc
accggcgccgtgtacccggaagagacgctgaagaagatcgtggcccttgccgagaaacat
ggcctggtcctttttgccgacgaaatctacgagaaaatcctctatgaggacgccgtccac
atcaacctggcggggcttaccggcgacgacgtcctgtgcctcaccttcagcggcctgtcc
aaggcctaccgggtgtgcgggtaccgggccgggtggatggccatttcggggccgaagaag
gatgccgccgactaccttgagggcatcagcctccttgccaacatgcgcctctgcgccaac
gtgccggcccagcacgccatccagaccgcactgggcggctaccagagcatcaacgacctg
atcctgccgggcgggcggctgctggagcagcgcaacaaggcgtacgacatgctcaacgcc
atcccgggcgtgagtactcagcaggcccgcggcgccctgtacctctttccgaagctcgac
ccggaggtttaccacatccgtgacgacgagaagttcgtcctggacctcctcagggagcaa
aaaatcctggtctcccacggccgggcgttcaactgggtgcgcccggaccacttccgcatg
gtgaccctgcccaacgtcaaggacatcgaggaagccgtgggccggatgggggacttccta
agcaggtaccaggggaactag

DBGET integrated database retrieval system