KEGG   Arthrobacter sp. PGP41: C3B78_16325Help
Entry
C3B78_16325       CDS       T05450                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
arth  Arthrobacter sp. PGP41
Pathway
arth00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:arth00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    C3B78_16325
Enzymes [BR:arth01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     C3B78_16325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Glyco_hydro_14
Motif
Other DBs
NCBI-ProteinID: AUZ35857
UniProt: A0A2L0R1Q6
LinkDB All DBs
Position
3559358..3561370
Genome map
AA seq 670 aa AA seqDB search
MDSQDIPRPASVWNHVEGIAYGGDYNPEQWPVSVRLEDLELMQEAGVNFLSVGIFSWALL
EPAEGKYNFGWLDEVLDNLHGIGVKVALATATAAPPAWLVRKHPEILPVTADGTVLGPGS
RRHYTPSSAVYRRYASGITRAVAERYKDHPALALWHVDNELGCHVYEFYGEEDAAAFRAW
LERRYGNIDALNAAWGTAFWSQNYGSFEEILPPAIAPSTLNPGQQLDFQRFNSRALMDYY
RELVAVLREVTPGVPCTTNLMASSATKSMDYFDWAKDLDVIANDHYLVAADPERHIELAF
SADLTRGIAGGDPWILMEHSTSAVNWQPRNQPKMPGEMLRNSLAHVARGADAVMFFQWRQ
SFAGSEKFHSAMVPHGGRDTRVWREVVELGADLKRLAPVRGSRVESRVAIVFDYEAWWAS
EIDSKPSIDVRYLDLQRAFHRSLFLRGVSVDFVHPSASLDGYGLVLVCTLYTVTDEAAAN
ISAAASAGATVLVSYFSGIVDGKDHVRLGGYPGAFRELLGVRVEEFHPLLAGTQLKLSDG
TVSSIWSEHVHLAGAEAMQAFTEYPLEGVPSLTRRAVGSGAAWYLATFPGPDGIDSVVDR
LLEESGVAPAAAGPGVELVRRRSADGQGFLFAINHTRSDAAVEASGQDLLTGEAFPGLVP
AGGVAVVAEG
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atggattcgcaggacatcccccggccggcaagcgtctggaaccatgtcgaaggcatcgct
tacggcggtgactacaatcccgagcagtggccggtcagcgtccgcctggaggacctggag
ctgatgcaggaagcgggcgtgaacttcctcagtgtgggaattttctcctgggcactgctg
gaacccgccgaagggaagtacaactttggctggctcgacgaggtgctggacaacctccat
ggcatcggcgtcaaggtggccctggccaccgccaccgctgctcccccggcatggctggta
cggaagcatccggaaatcctgccggtcacggctgacggaaccgtgctgggaccggggtca
cggcggcactacacgccgtcgtcggccgtttaccgccgctacgccagcggcatcacccgt
gcagtggccgagcgctacaaggaccaccccgccctggcgctctggcacgtggacaacgag
ctgggctgccatgtctacgagttctacggcgaggaggacgccgcggccttccgggcgtgg
ctggagcggcggtacgggaacatcgatgcactcaacgcagcgtggggcacggcgttctgg
tcgcagaactacggctcgttcgaggagatcctgccgcccgccattgcgccttccaccctg
aacccgggccagcagctggacttccagcggttcaactcccgggccctgatggactattat
cgcgaactcgttgcggtcctgcgggaggtcaccccgggcgttccgtgcaccaccaacctg
atggcctccagcgccaccaagtccatggactacttcgactgggccaaggacctggacgtc
atcgccaacgaccactacctcgtggccgccgaccccgaacggcacatcgaactcgcattc
agcgcggacctcacccgcggcatcgcgggaggtgacccgtggatcctgatggaacattcg
acgtcggccgtcaactggcagccgcgcaaccagcccaaaatgcccggagaaatgctgcgc
aactcgctcgcccacgtggcccgcggtgccgacgccgtcatgtttttccagtggcggcag
agcttcgccggctcggagaagttccactcggccatggtgccgcacggcggccgggacacc
cgggtgtggcgcgaggtggtggagctgggggcggacctgaagcggttggctccggtgcgc
ggttcgcgagtggaatcccgggttgcgatcgtgttcgactacgaggcctggtgggccagt
gagatcgactccaagccgagcattgacgtgcggtaccttgacctgcagcgggcgttccac
cgctcgctgttcctccggggcgtgtccgtggatttcgtgcacccttccgcttcccttgat
ggatacggcctcgtgctggtgtgcaccctgtacaccgtcactgacgaggccgcggccaac
atttccgctgcagcctccgccggcgccactgtgctggtgagctacttcagcgggatcgtg
gacgggaaggaccatgtccggctgggcggctatccgggcgcgttccgggagctgctgggc
gttcgggtggaggaattccatccgctgctggccgggacccaactgaagctgagcgacggg
accgtgtcttccatctggagcgagcacgtccacctggccggcgccgaagccatgcaggcg
tttaccgagtatccgctggaaggcgttccgtccctcacgcgacgggccgtgggttcgggc
gcggcctggtacctggccacgttccccggcccggacggcattgattccgtggtggaccgg
cttctggaagagtccggcgtagcccccgctgcggccggtcccggtgtggagctggtgcgg
cggcgctctgccgacgggcagggcttccttttcgcgatcaaccacacgcgttcggatgcc
gccgtggaggcatccggccaggatttgctgaccggcgaagcgtttccggggctggtcccg
gcgggcggcgtggcggtagttgcggagggctag

DBGET integrated database retrieval system